DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12374 and Cpa3

DIOPT Version :9

Sequence 1:NP_610819.1 Gene:CG12374 / 36410 FlyBaseID:FBgn0033774 Length:422 Species:Drosophila melanogaster
Sequence 2:NP_062173.1 Gene:Cpa3 / 54242 RGDID:2390 Length:417 Species:Rattus norvegicus


Alignment Length:401 Identity:116/401 - (28%)
Similarity:212/401 - (52%) Gaps:31/401 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 RYDHFRIYQLTIETNLQMEELKKIHEHISVHF-----LNELGAVGNKYNVIVGPLFHRALEKTLK 85
            ::|..:::::.::...|...||.:.:.|.:.|     :::: ||....:..|.....:.::.||:
  Rat    20 QFDREKVFRVKLQDEKQASILKNLTQTIELDFWYPDAIHDI-AVNMTVDFRVTEKESQTIQSTLE 83

  Fly    86 FLEIVYEVIVDDLQKLID------ESSVGDDSQMEWETYHTLDTIYDWIDQECAAHDFLECKV-I 143
            ..::.||::::|||:.||      |...|..|   :..|:..:.|..|.::....|..:..:: |
  Rat    84 QHKMDYEILINDLQEEIDKQFDVKEEIAGRHS---YAKYNDWNKIVSWTEKMVEKHPEMVSRIKI 145

  Fly   144 GQSYEGRDIKSIRLSKRSG-NKAIFLEGNIHAMEWISSATVTFLLNQLINS--EDPEMQRLSEEY 205
            |.:.|...:..:::.::.| .||||::..|||.||:|.|...:.:.|...|  ::..|.:|.:..
  Rat   146 GSTVEDNPLYVLKIGRKDGERKAIFMDCGIHAREWVSPAFCQWFVYQAAKSYGKNKIMTKLLDRM 210

  Fly   206 DWIVVPMVNPDGFVYTHEVERLWRKNRRPNGYRNESGDCYGIDMNRNFDYHWGGAGWNIDEPCDH 270
            ::.|:|:.|.||::::...:|:|||||.    :|.:..|.|.|:|||||..|..:. |.|.||..
  Rat   211 NFYVLPVFNVDGYIWSWTKDRMWRKNRS----KNPNSTCIGTDLNRNFDVSWDSSP-NTDNPCLS 270

  Fly   271 WFGGEEPNTEVEIISLQNFVSSFEDGYIRSYMAYHAYGQYVLLPYGHSNTEFPPNYEQMKRIAAA 335
            .:.|..|.:|.|..::.||:.|..:. |::|:.:|:|.|.:|.|||:: .:.|||::.:.::|..
  Rat   271 VYRGPAPESEKETKAVTNFIRSHLNS-IKAYITFHSYSQMLLFPYGYT-IKLPPNHQDLLKVARI 333

  Fly   336 FSDAAADVYGSTFTYGASGLLNYVVSGAAKDWAY--GVKKIPFTCTVELRDKGTFGFFLPSNQIT 398
            .:|..:..|.:.:.||......|..||::.||||  |:|   .|...||||||..||.||.::|.
  Rat   334 ATDVLSSRYETRYIYGPIASTIYKTSGSSLDWAYDLGIK---HTFAFELRDKGKSGFLLPESRIK 395

  Fly   399 EVGLEVTAGLK 409
            ....|....:|
  Rat   396 PTCKETMLSVK 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12374NP_610819.1 Propep_M14 34..104 CDD:280416 17/80 (21%)
M14_CP_A-B_like 118..415 CDD:199844 95/298 (32%)
Cpa3NP_062173.1 Propep_M14 28..102 CDD:280416 16/74 (22%)
Peptidase_M14_like 114..413 CDD:299699 96/306 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166351631
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 262 1.000 Inparanoid score I3014
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D208397at33208
OrthoFinder 1 1.000 - - FOG0000056
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X86
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
98.800

Return to query results.
Submit another query.