DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12374 and agbl5

DIOPT Version :9

Sequence 1:NP_610819.1 Gene:CG12374 / 36410 FlyBaseID:FBgn0033774 Length:422 Species:Drosophila melanogaster
Sequence 2:XP_017210489.1 Gene:agbl5 / 445479 ZFINID:ZDB-GENE-040822-29 Length:886 Species:Danio rerio


Alignment Length:111 Identity:31/111 - (27%)
Similarity:51/111 - (45%) Gaps:22/111 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   151 DIKSIRLSKRSGNKAIFLEGNIHAMEWISSATVTFLLNQLINSEDPEMQRLSEEYDWIVVPMVNP 215
            |:.:.|..:.:|.:..|:...:|..|..||......||.:::.|||..|.|...:.:.::||:||
Zfish   227 DLSTARSHRFTGKRVFFVSSRVHPGETPSSFVFNGFLNFILSQEDPRAQTLRRMFVFKLIPMLNP 291

  Fly   216 DGFVYTHEVERLWRKNRRPNGYRNESGDCYGIDMNRNF-----DYH 256
            ||.|..|              ||.:|   .|:::||.:     |.|
Zfish   292 DGVVRGH--------------YRTDS---RGVNLNRQYVNPSPDLH 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12374NP_610819.1 Propep_M14 34..104 CDD:280416
M14_CP_A-B_like 118..415 CDD:199844 31/111 (28%)
agbl5XP_017210489.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.