DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12374 and CG8945

DIOPT Version :9

Sequence 1:NP_610819.1 Gene:CG12374 / 36410 FlyBaseID:FBgn0033774 Length:422 Species:Drosophila melanogaster
Sequence 2:NP_573190.1 Gene:CG8945 / 32693 FlyBaseID:FBgn0030815 Length:1430 Species:Drosophila melanogaster


Alignment Length:460 Identity:123/460 - (26%)
Similarity:204/460 - (44%) Gaps:80/460 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 PGRMAARYDHFRIYQLTIETNLQ---MEELKKIHEHISVHFLNELGAVGNKYNVIVGPLFHRALE 81
            |.|::  ||.::|::|..:...|   :||.||..:.:.:.:|......| ..:|:|.|......:
  Fly   976 PRRIS--YDKYQIWRLKPQDEEQVRALEEFKKGEDGVKLQWLKGPSLRG-LTDVLVPPKMLVDFQ 1037

  Fly    82 KTLKFLEIVYEVIVDDLQKLIDESSVGDD---------------SQMEWETYHTLDTIYDWIDQE 131
            .||.:..|.:||::.|:.|.|......:|               ..|.|..||..|.|..:::..
  Fly  1038 GTLNYEGIAHEVLIFDVGKAIAYELTKEDYLQTTRPSKPRPTAPPPMTWNRYHNHDEIVKYLETV 1102

  Fly   132 CAAH-DFLECKVIGQSYEGR----------------------DIKSIRLSKRSGN-KAIFLEGNI 172
            ...| ..:|...||:|:|||                      .||..:..::||. .|:|:|...
  Fly  1103 RMRHPQLVELIHIGRSFEGRPLIVVKIESKQTAAAANNDGLHTIKRPKRKRKSGQANAVFVEAGA 1167

  Fly   173 HAMEWISSATVTFLLNQLI-------NSEDPEMQRLSEEYDWIVVPMVNPDGFVYTHEVERLWRK 230
            ..:.||..|..|:::.:|:       ::||.|..|   ...|.::|::||||:.|:||.:|.|:|
  Fly  1168 QGLAWIGPAAATWMIAELLRLMKTNKSNEDVEFIR---NTTWYIMPVLNPDGYAYSHEYDRFWKK 1229

  Fly   231 NRR------PNGY-----------RNESGDCYGIDMNRNFDYHWGGAGWNIDEPCDHWFGGEEPN 278
            :|.      |:|.           |.....|||:|::||:.||||..| :...||:.::.|..|.
  Fly  1230 SRSQHQTPPPSGLLDSAMTWLQQKRGPDKVCYGVDLDRNWLYHWGKRG-SSKAPCNEFYAGPAPF 1293

  Fly   279 TEVEIISLQNFVSSFEDGYIRSYMAYHAYGQYVLLPYGHSNTEFPPNYEQMKRIAAAFSDAAADV 343
            :|.|..::..|:..:.. .|:.|::..||||.:..|...::|......:....:|...:|.... 
  Fly  1294 SEPETKAVSEFLMDYRT-QIKLYISLQAYGQVISYPVKANSTFNSERLDDFLDVAMVGTDGLRK- 1356

  Fly   344 YGSTFTY--GASGLLNYVVSGAAKDWAYGVKKIPFTCTVELRDKGTFGFFLPSNQITEV---GLE 403
            .||...|  .||..|....||.|..:|.....|||:.|::|.|.|..|:.|||:.|...   ..|
  Fly  1357 KGSKSRYKVDASNDLIEQRSGCADAFAAYEIGIPFSYTLQLADNGVHGYLLPSSAIEPTARDAFE 1421

  Fly   404 VTAGL 408
            :.:|:
  Fly  1422 IISGM 1426

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12374NP_610819.1 Propep_M14 34..104 CDD:280416 19/72 (26%)
M14_CP_A-B_like 118..415 CDD:199844 96/344 (28%)
CG8945NP_573190.1 Propep_M14 988..1058 CDD:280416 18/70 (26%)
M14_CP_A-B_like 1089..1430 CDD:199844 96/344 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D208397at33208
OrthoFinder 1 1.000 - - FOG0000056
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11705
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.