DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12374 and CG31019

DIOPT Version :9

Sequence 1:NP_610819.1 Gene:CG12374 / 36410 FlyBaseID:FBgn0033774 Length:422 Species:Drosophila melanogaster
Sequence 2:NP_733391.1 Gene:CG31019 / 318558 FlyBaseID:FBgn0051019 Length:659 Species:Drosophila melanogaster


Alignment Length:270 Identity:64/270 - (23%)
Similarity:106/270 - (39%) Gaps:74/270 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 MEWE-TYHTLDTIYDWID-QECAAHDFLECKVIGQSYEGRD-----IKSIRLSKRSGN------- 163
            :.|. :|..|.:..:.|| ::.:...|..| |:.:|.:.|:     |..:...:||.|       
  Fly   174 LAWPYSYSRLQSYLNVIDARQGSDKRFTRC-VLVKSLQNRNVDLLTIDHVTAKQRSTNRLDRSFI 237

  Fly   164 KAIFLEGNIHAMEWISSATVTFLLNQLINSEDPEMQRLSEEYDWIVVPMVNPDGFVYTHEVERLW 228
            :.|.:....|:.|..:|.....|:..|:.:. |....|.:.:.:.:||||||||         ::
  Fly   238 RVIVVLCRTHSSEAPASHVCQGLIEFLVGNH-PIAAVLRDNFVFKIVPMVNPDG---------VF 292

  Fly   229 RKNRRPNGYRNESGDCYGIDMNRNFDYHWGGAGWNIDEPCDHWFGG---EEPNTEVE-------- 282
            ..|.|.|        ..|.|||||  :|.|.   ...:|..|...|   |..|::|.        
  Fly   293 LGNNRCN--------LMGQDMNRN--WHIGS---EFTQPELHAVKGMLKELDNSDVSRGIETDLI 344

  Fly   283 -IISLQNFVSSFEDGYIRSYMAYHA----YGQYVLLPYGHSNTEFPPNYEQMKR----------I 332
             ||.:.::..||:...|...:..||    :|.::   ||::       ||.:.|          .
  Fly   345 GIIFVCSYNISFQTYQIDFVIDLHANSSMHGCFI---YGNT-------YEDVYRYERHLVFPRLF 399

  Fly   333 AAAFSDAAAD 342
            |:...|..||
  Fly   400 ASNAQDYVAD 409

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12374NP_610819.1 Propep_M14 34..104 CDD:280416
M14_CP_A-B_like 118..415 CDD:199844 63/264 (24%)
CG31019NP_733391.1 M14_AGBL4_like 190..478 CDD:133118 61/254 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.