DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12374 and Cpa6

DIOPT Version :9

Sequence 1:NP_610819.1 Gene:CG12374 / 36410 FlyBaseID:FBgn0033774 Length:422 Species:Drosophila melanogaster
Sequence 2:XP_038965675.1 Gene:Cpa6 / 312913 RGDID:1311764 Length:290 Species:Rattus norvegicus


Alignment Length:271 Identity:90/271 - (33%)
Similarity:143/271 - (52%) Gaps:12/271 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   143 IGQSYEGRDIKSIRLSKRSG--NKAIFLEGNIHAMEWISSATVTFLLNQ--LINSEDPEMQRLSE 203
            ||:|:|||.:..|:|.::|.  .:|::::..|||.|||..|...:.:.:  |....||.|:::..
  Rat    17 IGRSFEGRSLLIIQLGRKSQVYKRAVWIDCGIHAREWIGPAFCQWFVKEAILTYKTDPAMRKMLN 81

  Fly   204 EYDWIVVPMVNPDGFVYTHEVERLWRKNRRPNGYRNESGDCYGIDMNRNFDYHWGGAGWNIDEPC 268
            ...:.::|::|.||:.::...:|.|||.|.    ||....|.|:|.|||:...|...|.:.| ||
  Rat    82 HLYFYIMPVLNVDGYHFSWTHDRFWRKTRS----RNSKFHCRGVDANRNWKVKWCDEGASAD-PC 141

  Fly   269 DHWFGGEEPNTEVEIISLQNFVSSFEDGYIRSYMAYHAYGQYVLLPYGHSNTEFPPNYEQMKRIA 333
            |..:.|..|.:|.|:.::.||:..... .||:|:::|||.|.:|.||.:.:... ||:..::..|
  Rat   142 DDTYCGPFPESEPEVKAVANFLRKHRK-RIRAYLSFHAYAQMLLYPYSYKHATI-PNFSCVEFAA 204

  Fly   334 AAFSDAAADVYGSTFTYGASGLLNYVVSGAAKDWAYGVKKIPFTCTVELRDKGTFGFFLPSNQIT 398
            .....|...|:|..:.:|.:....||.||.:.|||| ...||::...||||.|.|||.||...|.
  Rat   205 HKAVKALRSVHGIRYRHGPASQTLYVSSGNSMDWAY-KNGIPYSFAFELRDTGYFGFLLPEMLIK 268

  Fly   399 EVGLEVTAGLK 409
            ....|....:|
  Rat   269 PTCTETMLAVK 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12374NP_610819.1 Propep_M14 34..104 CDD:280416
M14_CP_A-B_like 118..415 CDD:199844 90/271 (33%)
Cpa6XP_038965675.1 Peptidase_M14_like 1..289 CDD:416253 90/271 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166351701
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 262 1.000 Inparanoid score I3014
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D208397at33208
OrthoFinder 1 1.000 - - FOG0000056
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X86
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
98.800

Return to query results.
Submit another query.