DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12374 and AGTPBP1

DIOPT Version :9

Sequence 1:NP_610819.1 Gene:CG12374 / 36410 FlyBaseID:FBgn0033774 Length:422 Species:Drosophila melanogaster
Sequence 2:NP_001273644.1 Gene:AGTPBP1 / 23287 HGNCID:17258 Length:1278 Species:Homo sapiens


Alignment Length:279 Identity:60/279 - (21%)
Similarity:82/279 - (29%) Gaps:115/279 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 YEVIVDDLQKLIDESSVGDDSQMEWETYHTLDTIYDWIDQECAAHDFLECKVI-------GQSYE 148
            |..:...||||              |:.|....||...|..|.......|.::       ...||
Human   904 YSTLQMHLQKL--------------ESAHNPQQIYFRKDVLCETLSGNSCPLVTITAMPESNYYE 954

  Fly   149 GRDIKSIRLSKRSGNKAIFLEGNIHAME----WISSATVTFLLNQLINSEDPEMQRLSEEYDWIV 209
                   .:........:||...:|..|    |:...|:.:|:     |.:|..|.|.|.|.:.:
Human   955 -------HICHFRNRPYVFLSARVHPGETNASWVMKGTLEYLM-----SNNPTAQSLRESYIFKI 1007

  Fly   210 VPMVNPDGFVYTHEVERLWRKNRRPNGYRNESGDCYGIDMNRNFDYHWGGAGWNIDEPCDHWFGG 274
            |||:||||.:               ||  |......|.|:||.         |....|..|    
Human  1008 VPMLNPDGVI---------------NG--NHRCSLSGEDLNRQ---------WQSPSPDLH---- 1042

  Fly   275 EEPNTEVEIISLQNFVSSFEDGYIRSYMAYHAYGQYVLLPYGHSNTEFPPNYEQMKRIAAAFSDA 339
              |.                        .|||.|   ||.|          ...:||:...:   
Human  1043 --PT------------------------IYHAKG---LLQY----------LAAVKRLPLVY--- 1065

  Fly   340 AADVYG-----STFTYGAS 353
             .|.:|     :.|.||.|
Human  1066 -CDYHGHSRKKNVFMYGCS 1083

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12374NP_610819.1 Propep_M14 34..104 CDD:280416 5/12 (42%)
M14_CP_A-B_like 118..415 CDD:199844 54/252 (21%)
AGTPBP1NP_001273644.1 M14_Nna1 911..1188 CDD:133116 59/272 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.