DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12374 and Agbl5

DIOPT Version :9

Sequence 1:NP_610819.1 Gene:CG12374 / 36410 FlyBaseID:FBgn0033774 Length:422 Species:Drosophila melanogaster
Sequence 2:XP_036020907.1 Gene:Agbl5 / 231093 MGIID:2441745 Length:1007 Species:Mus musculus


Alignment Length:200 Identity:51/200 - (25%)
Similarity:79/200 - (39%) Gaps:48/200 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 HRALE--KTLKFLEIVYEVIVDDLQKLIDESSVGDDSQMEW---ETYHT----LDTIYDWIDQEC 132
            ||.:|  ....|....|.....|.|.|:        ||::.   |.|.|    ||:||...:..|
Mouse   262 HRFVEGRGATTFFAFCYPFSYSDCQDLL--------SQLDQRFSENYSTHSSPLDSIYYHRELLC 318

  Fly   133 AAHDFL--------ECKVIGQSYEGR------DIKSIRLSKRSGNKAIFLEGNIHAMEWISSATV 183
            .:.|.|        .|..:....|.|      |:.:.|..:.:|.:..||...:|..|..||...
Mouse   319 YSLDGLRVDLLTITSCHGLRDDREPRLEQLFPDLGTPRPFRFTGKRIFFLSSRVHPGETPSSFVF 383

  Fly   184 TFLLNQLINSEDPEMQRLSEEYDWIVVPMVNPDGFVYTHEVERLWRKNRRPNGYRNESGDCYGID 248
            ...|:.::..:||..|.|...:.:.::||:||||.|..|              ||.:|   .|::
Mouse   384 NGFLDFILRPDDPRAQTLRRLFVFKLIPMLNPDGVVRGH--------------YRTDS---RGVN 431

  Fly   249 MNRNF 253
            :||.:
Mouse   432 LNRQY 436

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12374NP_610819.1 Propep_M14 34..104 CDD:280416 8/28 (29%)
M14_CP_A-B_like 118..415 CDD:199844 40/153 (26%)
Agbl5XP_036020907.1 Pepdidase_M14_N 102..>214 CDD:407865
M14_AGBL5_like 304..695 CDD:349455 38/149 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.