DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12374 and ccpp-1

DIOPT Version :9

Sequence 1:NP_610819.1 Gene:CG12374 / 36410 FlyBaseID:FBgn0033774 Length:422 Species:Drosophila melanogaster
Sequence 2:NP_491674.2 Gene:ccpp-1 / 172241 WormBaseID:WBGene00018995 Length:1015 Species:Caenorhabditis elegans


Alignment Length:297 Identity:61/297 - (20%)
Similarity:103/297 - (34%) Gaps:90/297 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 KSAPG--RMAARYDHFR-IYQLTIETNLQMEELKKIHEHISVHFLNELGAVGNKYNVIVGPLFHR 78
            :||.|  |:.....:|| :|....|....:||.||...:.|:.|           ||        
 Worm   667 ESANGWRRVGENVCYFRNLYINENEEKKNVEEQKKKKYYYSIRF-----------NV-------- 712

  Fly    79 ALEKTLKFLEIVYEVIVDDLQKLIDESSVGDDSQMEWETYHTLDTIYDWIDQECAAHDFLECKVI 143
            ..:.|.....|.|....                     ||..|::....:.:....:.:....||
 Worm   713 TFQNTGDICYIAYHYPY---------------------TYSFLNSSLSMLKKRKQENVYCREDVI 756

  Fly   144 GQSYEGRDIKSIRL------SKRSGNKAIFLEGNIHAMEWISSATVTFLLNQLINSEDPEMQRLS 202
            |.|..|..||.:.:      ::.:..:.|.|...:|..|..:|..:..:|..|:..:..||.||.
 Worm   757 GHSLAGNPIKMLTITTPASAAEIAAREVIVLSARVHPGETNASWIMQGILENLLCRQSNEMYRLR 821

  Fly   203 EEYDWIVVPMVNPDGFVY-TH-------EVERLWRK-----------------------NRRPNG 236
            |.:.:.:|||:||||... :|       ::.|:|.:                       |::|..
 Worm   822 ESFIFKIVPMINPDGVTNGSHRCSLAGIDLNRMWDRPNEALHPEVFATKAIIQYLCEVANKKPFA 886

  Fly   237 YRNESGDCYGIDMNRNFDYHWGG----AGWNIDEPCD 269
            |.:..|.      ::.:||...|    ..|..|:..|
 Worm   887 YVDIHGH------SKKWDYFVYGNNASESWRADDVLD 917

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12374NP_610819.1 Propep_M14 34..104 CDD:280416 12/69 (17%)
M14_CP_A-B_like 118..415 CDD:199844 41/193 (21%)
ccpp-1NP_491674.2 M14_Nna1_like_2 738..1011 CDD:199859 39/186 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.