DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12374 and CPA3

DIOPT Version :9

Sequence 1:NP_610819.1 Gene:CG12374 / 36410 FlyBaseID:FBgn0033774 Length:422 Species:Drosophila melanogaster
Sequence 2:NP_001861.2 Gene:CPA3 / 1359 HGNCID:2298 Length:417 Species:Homo sapiens


Alignment Length:436 Identity:118/436 - (27%)
Similarity:218/436 - (50%) Gaps:63/436 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LPILLITLVAMVAAKSAPGRMAARYDHFRIYQLTIETNLQ---MEELKKIHE----------HIS 54
            ||:.||.....:|        ..|:|..:::::..:...|   :::|.|.:|          |::
Human     5 LPVGLIATTLAIA--------PVRFDREKVFRVKPQDEKQADIIKDLAKTNELDFWYPGATHHVA 61

  Fly    55 VHFLNELGAVGNKYNVIVGPLFHRALEKTLKFLEIVYEVIVDDLQKLIDES-SVGDD--SQMEWE 116
            .:.:.:. .|..|.:        :|::..|...::.||:::.|||:.|::. .|.:|  .:..:.
Human    62 ANMMVDF-RVSEKES--------QAIQSALDQNKMHYEILIHDLQEEIEKQFDVKEDIPGRHSYA 117

  Fly   117 TYHTLDTIYDWIDQECAAHDFLECKV-IGQSYEGRDIKSIRL-SKRSGNKAIFLEGNIHAMEWIS 179
            .|:..:.|..|.::....:..:..:: ||.:.|...:..::: .|....||||.:..|||.||:|
Human   118 KYNNWEKIVAWTEKMMDKYPEMVSRIKIGSTVEDNPLYVLKIGEKNERRKAIFTDCGIHAREWVS 182

  Fly   180 ---------SATVTFLLNQLINSEDPEMQRLSEEYDWIVVPMVNPDGFVYTHEVERLWRKNRRPN 235
                     .||.|:..|::       |.:|.:..::.::|:.|.||::::....|:|||||.  
Human   183 PAFCQWFVYQATKTYGRNKI-------MTKLLDRMNFYILPVFNVDGYIWSWTKNRMWRKNRS-- 238

  Fly   236 GYRNESGDCYGIDMNRNFDYHWGGAGWNIDEPCDHWFGGEEPNTEVEIISLQNFVSSFEDGYIRS 300
              :|::..|.|.|:||||:..|.... |.::||...:.|..|.:|.|..::.||:.|..: .|:.
Human   239 --KNQNSKCIGTDLNRNFNASWNSIP-NTNDPCADNYRGSAPESEKETKAVTNFIRSHLN-EIKV 299

  Fly   301 YMAYHAYGQYVLLPYGHSNTEFPPNYEQMKRIAAAFSDAAADVYGSTFTYGASGLLNYVVSGAAK 365
            |:.:|:|.|.:|.|||:: ::.|||:|.:.::|...:|..:..|.:.:.||......|.:||::.
Human   300 YITFHSYSQMLLFPYGYT-SKLPPNHEDLAKVAKIGTDVLSTRYETRYIYGPIESTIYPISGSSL 363

  Fly   366 DWAY--GVKKIPFTCTVELRDKGTFGFFLPSNQITEVGLEVTAGLK 409
            ||||  |:|   .|...||||||.|||.||.::|.....|....:|
Human   364 DWAYDLGIK---HTFAFELRDKGKFGFLLPESRIKPTCRETMLAVK 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12374NP_610819.1 Propep_M14 34..104 CDD:280416 15/82 (18%)
M14_CP_A-B_like 118..415 CDD:199844 94/305 (31%)
CPA3NP_001861.2 Propep_M14 28..102 CDD:280416 15/82 (18%)
M14_CPB 114..413 CDD:199852 94/310 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165157649
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D208397at33208
OrthoFinder 1 1.000 - - FOG0000056
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X86
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.750

Return to query results.
Submit another query.