DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12374 and cpo

DIOPT Version :9

Sequence 1:NP_610819.1 Gene:CG12374 / 36410 FlyBaseID:FBgn0033774 Length:422 Species:Drosophila melanogaster
Sequence 2:NP_001139101.1 Gene:cpo / 100005630 ZFINID:ZDB-GENE-070619-6 Length:363 Species:Danio rerio


Alignment Length:307 Identity:99/307 - (32%)
Similarity:173/307 - (56%) Gaps:14/307 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 EWETYHTLDTIYDWIDQ-ECAAHDFLECKVIGQSYEGRDIKSIRL--SKRSGNKAIFLEGNIHAM 175
            ::..|||:|.|..|::| :....|.:.....||:||.|:|..:::  |..:..|||:::..|||.
Zfish    31 DYTKYHTMDEISAWMNQMQRENPDVVSTMTYGQTYEKRNITLLKIGFSSTTPKKAIWMDCGIHAR 95

  Fly   176 EWISSATVTFLLNQLINS--EDPEMQRLSEEYDWIVVPMVNPDGFVYT--HEVERLWRKNRRPNG 236
            |||:.|.....:.:::.|  .|..:..|.:..|:.:.|::|.||::|:  :...|||||:|.|  
Zfish    96 EWIAPAFCQHFVKEVLGSYKTDSRVNMLFKNLDFYITPVLNMDGYIYSWLNNSTRLWRKSRSP-- 158

  Fly   237 YRNESGDCYGIDMNRNFDYHWGGAGWNIDEPCDHWFGGEEPNTEVEIISLQNFVSSFEDGYIRSY 301
             .:|:..|.|.|:||||..:||..|.: ...|...:.|....:|.|..::.:|:.:.:: ::..|
Zfish   159 -CHENSTCSGTDLNRNFYANWGMVGIS-RNCCSEVYNGATALSEPEAEAVTDFLGAHQN-HLLCY 220

  Fly   302 MAYHAYGQYVLLPYGHSNTEFPPNYEQMKRIAAAFSDAAADVYGSTFTYGASGLLNYVVSGAAKD 366
            :..|:|||.:|:||||.|.. .|||:::..:..|.:.|...|:|.::..|:|..:.|..||:::|
Zfish   221 LTIHSYGQLILVPYGHPNIS-APNYDELMEVGLAAAKAIKAVHGKSYKVGSSPDVLYPNSGSSRD 284

  Fly   367 WAYGVKKIPFTCTVELRDKGTFGFFLPSNQITEVGLEVTAGLKALVN 413
            :|..: .||::.|.||||:|..||.||.:||.....|...|..:::|
Zfish   285 FARLI-GIPYSFTFELRDEGQHGFILPEDQIQPTCQEAYEGAMSIIN 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12374NP_610819.1 Propep_M14 34..104 CDD:280416
M14_CP_A-B_like 118..415 CDD:199844 99/303 (33%)
cpoNP_001139101.1 M14_CP_A-B_like 35..332 CDD:199844 99/303 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170593508
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D208397at33208
OrthoFinder 1 1.000 - - FOG0000056
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X86
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.750

Return to query results.
Submit another query.