DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nacalpha and EGD2

DIOPT Version :9

Sequence 1:NP_001286363.1 Gene:Nacalpha / 36409 FlyBaseID:FBgn0086904 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_012063.3 Gene:EGD2 / 856600 SGDID:S000001236 Length:174 Species:Saccharomyces cerevisiae


Alignment Length:163 Identity:68/163 - (41%)
Similarity:102/163 - (62%) Gaps:20/163 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 SRGEKKARKIMLKLGLKQIQGVNRVTIRKSKNILFVINNPDVYKNPHSDTYIVFGEAKIEDLSQQ 134
            ::.|||||:::.|||||||.|:.|||.||..|.::.|..|:|:::. ...|:||||||:::.:| 
Yeast    14 NKNEKKARELIGKLGLKQIPGIIRVTFRKKDNQIYAIEKPEVFRSA-GGNYVVFGEAKVDNFTQ- 76

  Fly   135 AQVAAAEK---------------FKAPEAAGAADSVGATTSVAPIAEEDEE--DVDDTGVDEKDI 182
             ::|||::               .|:||...|.....|..||...||||:|  :||...:::.||
Yeast    77 -KLAAAQQQAQASGIMPSNEDVATKSPEDIQADMQAAAEGSVNAAAEEDDEEGEVDAGDLNKDDI 140

  Fly   183 ELVITQANTTRAKAIKALKNNNNDIVNAIMELT 215
            |||:.|.|.::.:||||||.:|.|:|||||.|:
Yeast   141 ELVVQQTNVSKNQAIKALKAHNGDLVNAIMSLS 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NacalphaNP_001286363.1 EGD2 74..216 CDD:224227 67/159 (42%)
NAC 75..128 CDD:280093 26/52 (50%)
UBA_NAC_euk 179..215 CDD:270541 20/35 (57%)
EGD2NP_012063.3 EGD2 3..174 CDD:224227 68/163 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 61 1.000 Domainoid score I2521
eggNOG 1 0.900 - - E1_COG1308
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H123861
Inparanoid 1 1.050 112 1.000 Inparanoid score I1365
Isobase 1 0.950 - 0 Normalized mean entropy S811
OMA 1 1.010 - - QHG53634
OrthoFinder 1 1.000 - - FOG0000996
OrthoInspector 1 1.000 - - otm46597
orthoMCL 1 0.900 - - OOG6_101216
Panther 1 1.100 - - LDO PTHR21713
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R789
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.810

Return to query results.
Submit another query.