DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nacalpha and NACA3

DIOPT Version :9

Sequence 1:NP_001286363.1 Gene:Nacalpha / 36409 FlyBaseID:FBgn0086904 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_196889.4 Gene:NACA3 / 831231 AraportID:AT5G13850 Length:204 Species:Arabidopsis thaliana


Alignment Length:201 Identity:105/201 - (52%)
Similarity:135/201 - (67%) Gaps:24/201 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 EAKPEDVRVEDDGSDSDSDGGMPGLEEAVAATTQLGGGATGLPIDLVSKAKQSRGEKKARKIMLK 82
            |.:.:|...|||..|.|...|..|         :.||           ::||||.|||:||.|||
plant    24 EVEDDDDNDEDDSEDDDEAEGHDG---------EAGG-----------RSKQSRSEKKSRKAMLK 68

  Fly    83 LGLKQIQGVNRVTIRKSKNILFVINNPDVYKNPHSDTYIVFGEAKIEDLSQQAQVAAAEKFKAPE 147
            ||:|.|.||:|||::|||||||||:.|||:|:|.||||::||||||||||.|.|..|||:||||.
plant    69 LGMKPITGVSRVTVKKSKNILFVISKPDVFKSPASDTYVIFGEAKIEDLSSQLQSQAAEQFKAPN 133

  Fly   148 AAGAADSVGATTSVAPIA---EEDEEDVDDTGVDEKDIELVITQANTTRAKAIKALKNNNNDIVN 209
            .:... |.|.|:|.|..|   ::|:|:||:.||:.||||||:|||..::.:|:||||..|.|||:
plant   134 LSNVI-SQGETSSAATAAAVQDDDDEEVDEEGVEPKDIELVMTQAGVSKPRAVKALKLANGDIVS 197

  Fly   210 AIMELT 215
            ||||||
plant   198 AIMELT 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NacalphaNP_001286363.1 EGD2 74..216 CDD:224227 89/145 (61%)
NAC 75..128 CDD:280093 37/52 (71%)
UBA_NAC_euk 179..215 CDD:270541 22/35 (63%)
NACA3NP_196889.4 NAC_NACA 70..117 CDD:409233 33/46 (72%)
UBA_NAC_euk 167..203 CDD:270541 22/35 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 89 1.000 Domainoid score I2687
eggNOG 1 0.900 - - E1_COG1308
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 189 1.000 Inparanoid score I1393
OMA 1 1.010 - - QHG53634
OrthoDB 1 1.010 - - D1331328at2759
OrthoFinder 1 1.000 - - FOG0000996
OrthoInspector 1 1.000 - - otm2986
orthoMCL 1 0.900 - - OOG6_101216
Panther 1 1.100 - - O PTHR21713
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2513
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.840

Return to query results.
Submit another query.