DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nacalpha and NACA2

DIOPT Version :9

Sequence 1:NP_001286363.1 Gene:Nacalpha / 36409 FlyBaseID:FBgn0086904 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_001327011.1 Gene:NACA2 / 824109 AraportID:AT3G49470 Length:232 Species:Arabidopsis thaliana


Alignment Length:209 Identity:96/209 - (45%)
Similarity:138/209 - (66%) Gaps:22/209 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 PELTEIKSEAAPSTSAEAKP--EDVRVEDDGSDSDSDGGMPGLEEAVAATTQLGGGATGLPIDLV 64
            |.:|.|..|.......: :|  |||:.::|..|.|.:      ||...|.     |.:|      
plant    19 PPVTAIAEELEKKLQTD-EPIVEDVKDDEDDDDDDEE------EEDDDAQ-----GVSG------ 65

  Fly    65 SKAKQSRGEKKARKIMLKLGLKQIQGVNRVTIRKSKNILFVINNPDVYKNPHSDTYIVFGEAKIE 129
             .:||||.|||:||.|||||:|.:.||:||||:::||:||.|:.|||:|:|||:||::|||||||
plant    66 -SSKQSRSEKKSRKAMLKLGMKPVTGVSRVTIKRTKNVLFFISKPDVFKSPHSETYVIFGEAKIE 129

  Fly   130 DLSQQAQVAAAEKFKAPEAAGAADSVGATT-SVAPIAEEDEEDVDDTGVDEKDIELVITQANTTR 193
            |||.|.|..||::|:.||....:....|:| :|....|||||::|:|||:.:||:||:|||..:|
plant   130 DLSSQLQTQAAQQFRMPEIGATSQRAEASTATVEAQVEEDEEEIDETGVEARDIDLVMTQAGVSR 194

  Fly   194 AKAIKALKNNNNDI 207
            :||:||||:::.||
plant   195 SKAVKALKSHDGDI 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NacalphaNP_001286363.1 EGD2 74..216 CDD:224227 75/135 (56%)
NAC 75..128 CDD:280093 33/52 (63%)
UBA_NAC_euk 179..215 CDD:270541 16/29 (55%)
NACA2NP_001327011.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 98 1.000 Domainoid score I2404
eggNOG 1 0.900 - - E1_COG1308
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H123861
Inparanoid 1 1.050 189 1.000 Inparanoid score I1393
OMA 1 1.010 - - QHG53634
OrthoDB 1 1.010 - - D1331328at2759
OrthoFinder 1 1.000 - - FOG0000996
OrthoInspector 1 1.000 - - otm2986
orthoMCL 1 0.900 - - OOG6_101216
Panther 1 1.100 - - LDO PTHR21713
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2513
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.840

Return to query results.
Submit another query.