DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nacalpha and NACA

DIOPT Version :9

Sequence 1:NP_001286363.1 Gene:Nacalpha / 36409 FlyBaseID:FBgn0086904 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_001352825.1 Gene:NACA / 4666 HGNCID:7629 Length:2078 Species:Homo sapiens


Alignment Length:215 Identity:132/215 - (61%)
Similarity:155/215 - (72%) Gaps:8/215 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 KSEAAPSTSAEAK-PEDVRVEDDGSDSDSDGGMPGLEE--AVAATTQLGGGATGLPID--LVSKA 67
            ||...|..:..|| |.....:..|::||||..:|.|||  :..||||....|....||  .||||
Human  1866 KSAGIPVPTPSAKQPVTKNNKGSGTESDSDESVPELEEQDSTQATTQQAQLAAAAEIDEEPVSKA 1930

  Fly    68 KQSRGEKKARKIMLKLGLKQIQGVNRVTIRKSKNILFVINNPDVYKNPHSDTYIVFGEAKIEDLS 132
            ||||.||||||.|.||||:|:.||.||||||||||||||..|||||:|.||||||||||||||||
Human  1931 KQSRSEKKARKAMSKLGLRQVTGVTRVTIRKSKNILFVITKPDVYKSPASDTYIVFGEAKIEDLS 1995

  Fly   133 QQAQVAAAEKFKAPEAAGAADSVGATTSVAPIAEE-DEEDVDDTGVDEKDIELVITQANTTRAKA 196
            ||||:|||||||.  ...|..::...|....:.|| :||:||:|||:.||||||::|||.:||||
Human  1996 QQAQLAAAEKFKV--QGEAVSNIQENTQTPTVQEESEEEEVDETGVEVKDIELVMSQANVSRAKA 2058

  Fly   197 IKALKNNNNDIVNAIMELTM 216
            ::|||||:||||||||||||
Human  2059 VRALKNNSNDIVNAIMELTM 2078

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NacalphaNP_001286363.1 EGD2 74..216 CDD:224227 99/142 (70%)
NAC 75..128 CDD:280093 42/52 (81%)
UBA_NAC_euk 179..215 CDD:270541 27/35 (77%)
NACANP_001352825.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..21
Atrophin-1 <2..395 CDD:331285
DNA_pol3_gamma3 <8..>184 CDD:331207
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 37..96
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 595..614
Atrophin-1 <720..1121 CDD:331285
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 732..1944 36/77 (47%)
Atrophin-1 <1273..1839 CDD:331285
PXLXP. /evidence=ECO:0000250|UniProtKB:P70670 1841..1845
Required for DNA-binding. /evidence=ECO:0000250|UniProtKB:P70670 1932..1943 9/10 (90%)
NAC 1945..1991 CDD:307801 37/45 (82%)
UBA_NACA_NACP1 2032..2077 CDD:270598 33/44 (75%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 104 1.000 Domainoid score I6694
eggNOG 1 0.900 - - E1_COG1308
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S811
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1331328at2759
OrthoFinder 1 1.000 - - FOG0000996
OrthoInspector 1 1.000 - - otm41188
orthoMCL 1 0.900 - - OOG6_101216
Panther 1 1.100 - - LDO PTHR21713
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R789
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1110.760

Return to query results.
Submit another query.