DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nacalpha and NACA2

DIOPT Version :9

Sequence 1:NP_001286363.1 Gene:Nacalpha / 36409 FlyBaseID:FBgn0086904 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_954984.1 Gene:NACA2 / 342538 HGNCID:23290 Length:215 Species:Homo sapiens


Alignment Length:214 Identity:120/214 - (56%)
Similarity:149/214 - (69%) Gaps:10/214 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 SEAAPSTSAEAKPEDVRVEDDGSDSDSDGGMPGLEE--AVAATTQLGGGATGLPID--LVSKAKQ 69
            :|..|:|..|. |:.......|:.|||...:||:||  :...|||.........||  .|.||||
Human     6 TETVPATEQEL-PQSQAETGSGTASDSGESVPGIEEQDSTQTTTQKAWLVAAAEIDEEPVGKAKQ 69

  Fly    70 SRGEKKARKIMLKLGLKQIQGVNRVTIRKSKNILFVINNPDVYKNPHSDTYIVFGEAKIEDLSQQ 134
            ||.||:|||.|.||||.|:.||.||||.|||||||||...||||:|.||.|||||||||:|||||
Human    70 SRSEKRARKAMSKLGLLQVTGVTRVTIWKSKNILFVITKLDVYKSPASDAYIVFGEAKIQDLSQQ 134

  Fly   135 AQVAAAEKFKAP-EAAGAADSVGATTSVAPIAEE-DEEDVDDTGVDEKDIELVITQANTTRAKAI 197
            ||:||||||:.. ||.|   ::...|....:.|| :||:||:|||:.||::||::|||.:||||:
Human   135 AQLAAAEKFRVQGEAVG---NIQENTQTPTVQEESEEEEVDETGVEVKDVKLVMSQANVSRAKAV 196

  Fly   198 KALKNNNNDIVNAIMELTM 216
            :|||||:|||||||||||:
Human   197 RALKNNSNDIVNAIMELTV 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NacalphaNP_001286363.1 EGD2 74..216 CDD:224227 93/143 (65%)
NAC 75..128 CDD:280093 38/52 (73%)
UBA_NAC_euk 179..215 CDD:270541 25/35 (71%)
NACA2NP_954984.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..51 16/45 (36%)
NAC 82..128 CDD:307801 34/45 (76%)
UBA_NACA_NACP1 174..214 CDD:270598 28/39 (72%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 104 1.000 Domainoid score I6694
eggNOG 1 0.900 - - E1_COG1308
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 203 1.000 Inparanoid score I3752
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53634
OrthoDB 1 1.010 - - D1331328at2759
OrthoFinder 1 1.000 - - FOG0000996
OrthoInspector 1 1.000 - - otm41188
orthoMCL 1 0.900 - - OOG6_101216
Panther 1 1.100 - - O PTHR21713
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2513
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1312.840

Return to query results.
Submit another query.