DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nacalpha and Hmr

DIOPT Version :9

Sequence 1:NP_001286363.1 Gene:Nacalpha / 36409 FlyBaseID:FBgn0086904 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_572637.2 Gene:Hmr / 31988 FlyBaseID:FBgn0001206 Length:1413 Species:Drosophila melanogaster


Alignment Length:163 Identity:34/163 - (20%)
Similarity:56/163 - (34%) Gaps:43/163 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 AKPEDVRVEDDGSDSDSDGGMPGLEEAVAATTQLGGGATGLPIDLVSKAKQSRGEKKARKIMLKL 83
            ||...|......|.||       ::...||:..||.....||:..::.... ..:....::.:..
  Fly   830 AKLPTVAKATTASQSD-------IKATAAASATLGSQPENLPLGNITVCLH-ESDTTGNELQVWC 886

  Fly    84 GLKQIQGVNRVTIRKSKNILFVINNPDVYKNPHSDTYIVFGEAKIEDLSQQAQVAA--------- 139
            | .|....|...||.:..|..|:..|.::|                   :..|:||         
  Fly   887 G-NQGTRFNLNMIRTTTLIREVMAVPQLHK-------------------EDPQLAAKCVEFWHFI 931

  Fly   140 AEKFKAPEAA------GAADSVGATTSVAPIAE 166
            |:||..||.|      ..|.::.....:||::|
  Fly   932 AKKFHMPEEALRACWKFLAANMSVFPKIAPMSE 964

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NacalphaNP_001286363.1 EGD2 74..216 CDD:224227 22/108 (20%)
NAC 75..128 CDD:280093 9/52 (17%)
UBA_NAC_euk 179..215 CDD:270541
HmrNP_572637.2 MADF_DNA_bdg 59..149 CDD:287510
GT1 213..295 CDD:304916
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456649
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.