DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nacalpha and Nacad

DIOPT Version :9

Sequence 1:NP_001286363.1 Gene:Nacalpha / 36409 FlyBaseID:FBgn0086904 Length:217 Species:Drosophila melanogaster
Sequence 2:XP_038947687.1 Gene:Nacad / 289786 RGDID:1559824 Length:1696 Species:Rattus norvegicus


Alignment Length:213 Identity:114/213 - (53%)
Similarity:144/213 - (67%) Gaps:14/213 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 EAKPEDVRVED------DGSDSDSDGGMPG-LEEAVAATTQLGGGA---TGLPIDLVSKAKQSRG 72
            |.:.||...||      .|..|:|.|...| |:|...:..:....|   .|...:..:||||||.
  Rat  1484 EQEDEDSLEEDSQRAPGSGQHSESHGESSGELDEQDISPQKSQCPAQDPAGSNEETTAKAKQSRS 1548

  Fly    73 EKKARKIMLKLGLKQIQGVNRVTIRKSKNILFVINNPDVYKNPHSDTYIVFGEAKIEDLSQQAQV 137
            ||||||.|.||||:|||||.|:||:|||||||||..|||:|:|.||||:|||||||||||||...
  Rat  1549 EKKARKAMSKLGLRQIQGVTRITIQKSKNILFVIAKPDVFKSPASDTYVVFGEAKIEDLSQQVHK 1613

  Fly   138 AAAEKFKAP-EAAGAADSVGATTSVAPIA---EEDEEDVDDTGVDEKDIELVITQANTTRAKAIK 198
            |||||||.| |::.....:.....|.|..   ||:||:|::.|::.:|||||:.|||.:||||::
  Rat  1614 AAAEKFKVPSESSALVPELAPGPRVRPECEEQEEEEEEVEEAGLEPRDIELVMAQANVSRAKAVR 1678

  Fly   199 ALKNNNNDIVNAIMELTM 216
            |||:|::|||||||||||
  Rat  1679 ALKDNHSDIVNAIMELTM 1696

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NacalphaNP_001286363.1 EGD2 74..216 CDD:224227 91/145 (63%)
NAC 75..128 CDD:280093 40/52 (77%)
UBA_NAC_euk 179..215 CDD:270541 24/35 (69%)
NacadXP_038947687.1 PRK14949 <688..1044 CDD:237863
PHA03247 <839..1385 CDD:223021
NAC_NACA 1560..1607 CDD:409233 36/46 (78%)
UBA_NACAD 1655..1696 CDD:270599 26/40 (65%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166340757
Domainoid 1 1.000 93 1.000 Domainoid score I7376
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1331328at2759
OrthoFinder 1 1.000 - - FOG0000996
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR21713
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.950

Return to query results.
Submit another query.