DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nacalpha and nacad

DIOPT Version :9

Sequence 1:NP_001286363.1 Gene:Nacalpha / 36409 FlyBaseID:FBgn0086904 Length:217 Species:Drosophila melanogaster
Sequence 2:XP_012819673.1 Gene:nacad / 100127557 XenbaseID:XB-GENE-5961006 Length:1937 Species:Xenopus tropicalis


Alignment Length:231 Identity:118/231 - (51%)
Similarity:149/231 - (64%) Gaps:18/231 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 PELTEIKSEAAPSTSAEAKP-------EDVRVEDDGSDSDS-DGGMPGLEEAVAATTQLGGGATG 58
            ||:..::..:|.:.....||       |.:......:|::| |..:|.|||......:.......
 Frog  1709 PEMHSLRETSAVTLLGITKPGPRQRGCESLSHRGSCNDTESNDESLPELEEPDVTEPRTSSSQNQ 1773

  Fly    59 LP------IDLVSKAKQSRGEKKARKIMLKLGLKQIQGVNRVTIRKSKNILFVINNPDVYKNPHS 117
            |.      .:.:|||||||.||||||.|.||||:||.||.|:||||||||||||..|||:|:|.|
 Frog  1774 LAHCVAPGEESISKAKQSRSEKKARKAMSKLGLRQIHGVTRITIRKSKNILFVITKPDVFKSPAS 1838

  Fly   118 DTYIVFGEAKIEDLSQQAQVAAAEKFKAPEAAGAADSVGATTSVAPIAE--EDEEDVDDTGVDEK 180
            |.|||||||||||||||...|||||||.|  ...:..:..||....|.|  |:||:||:||::.:
 Frog  1839 DIYIVFGEAKIEDLSQQVHKAAAEKFKVP--MEHSPLITETTPTLTIKEESEEEEEVDETGLEVR 1901

  Fly   181 DIELVITQANTTRAKAIKALKNNNNDIVNAIMELTM 216
            |||||:.|||.:||||::||::||||||||||||||
 Frog  1902 DIELVMAQANVSRAKAVRALRHNNNDIVNAIMELTM 1937

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NacalphaNP_001286363.1 EGD2 74..216 CDD:224227 94/143 (66%)
NAC 75..128 CDD:280093 40/52 (77%)
UBA_NAC_euk 179..215 CDD:270541 25/35 (71%)
nacadXP_012819673.1 MSCRAMM_SdrC <544..769 CDD:380146
NAC 1796..1849 CDD:376630 40/52 (77%)
UBA_NACAD 1894..1937 CDD:270599 29/42 (69%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 104 1.000 Domainoid score I6616
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000996
OrthoInspector 1 1.000 - - otm48399
Panther 1 1.100 - - O PTHR21713
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
66.010

Return to query results.
Submit another query.