DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dgkepsilon and CG34384

DIOPT Version :9

Sequence 1:NP_001286362.1 Gene:Dgkepsilon / 36408 FlyBaseID:FBgn0020930 Length:534 Species:Drosophila melanogaster
Sequence 2:NP_001246971.1 Gene:CG34384 / 5740362 FlyBaseID:FBgn0085413 Length:1936 Species:Drosophila melanogaster


Alignment Length:446 Identity:125/446 - (28%)
Similarity:187/446 - (41%) Gaps:98/446 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 EDFVSTFKT----------------------RHSWKSIKVLEQACFCNVCEILLT--PSAGLFCD 73
            ||::.:.||                      .|.|.:.. ..:..:||||...|:  .|.||.|:
  Fly   164 EDWLGSLKTATAPQRPRGDSFLIEQHDILSNHHHWYATS-HARPTYCNVCRDALSGVTSHGLSCE 227

  Fly    74 CCGLCTHATPPCQRRADREYRCKDKWLRN--------------ESS----VRHLWVHGNLPMGVH 120
            .|....|.            ||..|.:.|              |.:    :.|.|:.||||:...
  Fly   228 VCKCKVHK------------RCAAKSIANCKWTTLASVGKDIIEQADGIIMPHQWMEGNLPVSSM 280

  Fly   121 CADCNEEVDHHVSTDPGLYGWRCAWCQRCYHNDCYTRADSMEACDLGEFKDMIFPPYSFVAARTR 185
            ||.|.:.....:.    |..|||.||:...|..|  |.....||.:|..|..:.||.|..:..|.
  Fly   281 CAVCKKTCGSVLR----LQDWRCLWCRATVHVAC--RPQMAVACPIGPAKLSVVPPTSVHSISTD 339

  Fly   186 DSMRLHLASITPPDIENWEPLIVIANTKSGSSTGANVLSLLRGYLHPLQVMELGSRGPQDALQWA 250
            |:.     .:..|. .|:.||:|..|:|||.:.|...|...:..|:|.||.:|.|.||...|:..
  Fly   340 DAW-----DVASPK-GNFSPLLVFVNSKSGDNQGVKFLRRFKQLLNPAQVFDLISTGPSLGLRLF 398

  Fly   251 AKASPRPCRILVAGGDGTIGWVLNTIYTLNIKPQPSVAIMPLGTGNDLSRVLGWGAEPPSVLDPV 315
            ...  ...||||..|||::||||:.|...|:..|..||:|||||||||:||||||:.........
  Fly   399 RHF--EMFRILVCSGDGSVGWVLSEIDRFNMHKQCQVAVMPLGTGNDLARVLGWGSSCDDDTHLP 461

  Fly   316 KILRSIRRARSVNLDRFDLQI-EKLHYRLPIQRHPTKTIHVYNYFSVGVDAYIT-----YNFH-- 372
            :||.....|.:..|||:.:.: ||   .:|:.:.|..:|      |...:|.:|     .|.|  
  Fly   462 QILERYESASTKMLDRWSIMVFEK---AIPVPKTPKMSI------STEQEAMLTGMVTSANHHLR 517

  Fly   373 ---KTRESRFYLLSSR--------IFNKLLYFTFGTQQVMQPGCEHIEEKLTLYLD 417
               :|.:::..:.|:|        :..::.......:| :...|:.:.:||.:.||
  Fly   518 FIVETNDTQTLIRSTRNLCDTVDDLVCRISEHHKDDEQ-LAVKCDILRQKLNMLLD 572

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DgkepsilonNP_001286362.1 C1_1 108..165 CDD:278556 19/56 (34%)
LCB5 207..519 CDD:224513 72/230 (31%)
DAGKc 207..331 CDD:214487 51/123 (41%)
DAGK_acc 355..510 CDD:279003 14/81 (17%)
CG34384NP_001246971.1 PH 83..175 CDD:278594 4/10 (40%)
PH_DGK_type2 84..180 CDD:270093 4/15 (27%)
C1 196..245 CDD:197519 16/61 (26%)
C1 268..318 CDD:197519 18/55 (33%)
DAGKc 355..477 CDD:214487 51/123 (41%)
DAGK_acc 1478..1635 CDD:279003
SAM_DGK-delta-eta 1869..1933 CDD:188906
SAM 1872..1935 CDD:197735
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462334
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D16095at33392
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11255
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.