DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dgkepsilon and dgkq

DIOPT Version :9

Sequence 1:NP_001286362.1 Gene:Dgkepsilon / 36408 FlyBaseID:FBgn0020930 Length:534 Species:Drosophila melanogaster
Sequence 2:XP_005174501.1 Gene:dgkq / 101882539 -ID:- Length:295 Species:Danio rerio


Alignment Length:296 Identity:63/296 - (21%)
Similarity:95/296 - (32%) Gaps:97/296 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 GVHCADCNEEVDHHV-STDPGLYGWRCAWCQRCYHNDCYTRADSMEACDLGEFKDMIFPPYSFVA 181
            |..|..|     |.| |:...|.|.||.||....|..|...::    |..|..::||..| ..|.
Zfish     4 GARCELC-----HRVCSSSDVLAGIRCEWCGITAHASCCVSSE----CVFGRLRNMILQP-GCVR 58

  Fly   182 ARTRDSMRLHLASITP----------PDIENWEPLIV-IANTKSGSSTGANVL------------ 223
            ..:|:..::|...|:.          .|::...|:.. .|.:.|...||...|            
Zfish    59 ICSRNFSKMHCYRISESSQHSDMDNLDDVDTQSPVTARDAQSSSSPDTGKQTLKVFDGDDAAKRN 123

  Fly   224 ------------------SLLRGYLHP--LQVMELGSRGPQ---------------------DAL 247
                              |.||.:..|  .|..||.|.|.|                     ||.
Zfish   124 LFRLVSIPRIIKNEEVVESALRAFYIPDEAQDYELQSYGQQGLFTEDIINRNGTPDNKSVFKDAA 188

  Fly   248 --QWAAKASPRPCRILVAGGDGTIGWVLNTIYTLNIKPQPSVAIMPLGTGNDLSRV-------LG 303
              .|..:|.||...::             .||...:|...|...:..|.|:.::.|       ||
Zfish   189 SDSWLLRAKPRDTEVV-------------KIYPGLLKVGVSYISVTAGRGSTVNSVITEALAQLG 240

  Fly   304 WGAEPPSVLDPVKILRSIRRARSVNLDRFDLQIEKL 339
            ...|.|...:.|::..|.::.:...|...:|.::||
Zfish   241 KQNENPDDFNLVEVFMSSKQVQRQILSGQELLLDKL 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DgkepsilonNP_001286362.1 C1_1 108..165 CDD:278556 14/47 (30%)
LCB5 207..519 CDD:224513 38/196 (19%)
DAGKc 207..331 CDD:214487 35/186 (19%)
DAGK_acc 355..510 CDD:279003
dgkqXP_005174501.1 C1 3..42 CDD:294036 14/46 (30%)
UBQ 107..>158 CDD:294102 7/50 (14%)
UBQ 200..280 CDD:294102 17/90 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1275907at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.