DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL18 and AT3G45020

DIOPT Version :10

Sequence 1:NP_610818.1 Gene:mRpL18 / 36406 FlyBaseID:FBgn0026741 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_190088.1 Gene:AT3G45020 / 823637 AraportID:AT3G45020 Length:133 Species:Arabidopsis thaliana


Alignment Length:129 Identity:29/129 - (22%)
Similarity:61/129 - (47%) Gaps:20/129 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 HTLEINTSGRYVSGDVKHFENGTIL-SASTSEWAIKQQLY--KTNDTSAFVNLGRVLAQRCLQSG 122
            :.|.:..|.:|::.:|....||.|: :|||.|..||..|.  :|.:..|...:|.|||.|....|
plant     7 YVLRLFMSIKYITANVVDRNNGRIVTTASTVEHTIKNSLECGRTCNAKAAAIVGEVLAMRLKVEG 71

  Fly   123 ITE-MTCNVEAVPGSKLQK-----------LLQTIQDNGVSFKEPSRLPNEQPWDEKRHEKPWE 174
            :.: ....:.|....:::|           ::.::::|||:.     :.::...|::..::.:|
plant    72 LQDGQGRGIHADVKKEIEKKGFKSRTKVWAVINSLRNNGVTL-----ILDDDDDDDEYRDRSFE 130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL18NP_610818.1 Ribosomal_L18_L5e 50..150 CDD:238246 25/103 (24%)
AT3G45020NP_190088.1 Ribosomal_L18_L5e 4..85 CDD:444873 23/77 (30%)

Return to query results.
Submit another query.