DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mos and RIPK2

DIOPT Version :9

Sequence 1:NP_610817.1 Gene:Mos / 36404 FlyBaseID:FBgn0033773 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_003812.1 Gene:RIPK2 / 8767 HGNCID:10020 Length:540 Species:Homo sapiens


Alignment Length:400 Identity:89/400 - (22%)
Similarity:147/400 - (36%) Gaps:125/400 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 PPVP----TRCQVLGRGAYGTVFKAIYRDRSVAVKIIRAQAASTLHNESHLLNLEHRNIVRLLKL 79
            |.:|    ...:.|.|||.|||..|.:.|..|.|      |...||..:.||:.|.::::|..::
Human    11 PTIPYHKLADLRYLSRGASGTVSSARHADWRVQV------AVKHLHIHTPLLDSERKDVLREAEI 69

  Fly    80 ESAADF----------------GLVIMECPRGQSLQRIV------DTLALPLMHRVLITLDVVAA 122
            ...|.|                |:|....|.| ||..::      ..:|.||..|:|  .::...
Human    70 LHKARFSYILPILGICNEPEFLGIVTEYMPNG-SLNELLHRKTEYPDVAWPLRFRIL--HEIALG 131

  Fly   123 LRYCHSQN--VLHLDVKPTNILVALGTKSSITCNSSKIKVKRSYICKLCDFGSSIEMGEFCAWQE 185
            :.|.|:..  :||.|:|..|||                 :...:..|:.|||.|       .|:.
Human   132 VNYLHNMTPPLLHHDLKTQNIL-----------------LDNEFHVKIADFGLS-------KWRM 172

  Fly   186 PSVAK----------GTLRYMSPEALRSDTLTEAS---DIYSLGITMWQLQARRLPYHTLDCNET 237
            .|:::          ||:.||.||.......:.||   ||||..:..|::.:|:.|:..:.....
Human   173 MSLSQSRSSKSAPEGGTIIYMPPENYEPGQKSRASIKHDIYSYAVITWEVLSRKQPFEDVTNPLQ 237

  Fly   238 IAYQ-------VVKHELRP-DNYHQLKILALDSPIDCDWDLAHESTANVICRRANTSARRN---- 290
            |.|.       |:..|..| |..|:.::::|   |:..|             ..|...|.:    
Human   238 IMYSVSQGHRPVINEESLPYDIPHRARMISL---IESGW-------------AQNPDERPSFLKC 286

  Fly   291 -LSLDPSYTVGRD---------LKKKR-----------HRNRLALHFDSPAPEGSACSESAYSQL 334
             :.|:|......:         |||.:           .:.::.|..:.|...|........|||
Human   287 LIELEPVLRTFEEITFLEAVIQLKKTKLQSVSSAIHLCDKKKMELSLNIPVNHGPQEESCGSSQL 351

  Fly   335 YKSCWVSAPE 344
            :::.  .:||
Human   352 HENS--GSPE 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MosNP_610817.1 STKc_Mos 19..298 CDD:270881 78/332 (23%)
S_TKc 26..257 CDD:214567 69/275 (25%)
RIPK2NP_003812.1 STKc_RIP2 20..303 CDD:270928 76/331 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 338..369 5/23 (22%)
CARD_RIP2_CARD3 438..524 CDD:176764
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0192
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.