DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mos and AT1G64300

DIOPT Version :9

Sequence 1:NP_610817.1 Gene:Mos / 36404 FlyBaseID:FBgn0033773 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_001031229.1 Gene:AT1G64300 / 842736 AraportID:AT1G64300 Length:717 Species:Arabidopsis thaliana


Alignment Length:292 Identity:56/292 - (19%)
Similarity:95/292 - (32%) Gaps:117/292 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 SHLLNLEHRNIVRLLKLESAADFGLVIMECPRGQSLQRIVDTLALPLMHRVL------------- 114
            |.||:|.|.||::.|    ...:.....||           :|.:.|||:.|             
plant   279 SSLLSLCHSNILQYL----CGFYDEERKEC-----------SLVMELMHKDLKSYMKENCGPRRR 328

  Fly   115 ----------ITLDVVAALRYCHSQNVLHLDVKPTNILVALGTKSSITCNSSKIKVKRSYICKLC 169
                      |.|.:...:.|.||..:.|.|:.|.|||:           ..:...:..:..|:.
plant   329 YLFSVPVVIDIMLQIARGMEYLHSNEIFHGDLNPMNILL-----------KERSHTEGYFHAKIS 382

  Fly   170 DFG-SSIEMGEF------------CAWQEPSVAKGTLRYMSPEALRSDTLTEASDIYSLGITMWQ 221
            .|| :|::...|            ..|..|.|.....:.:...|.|| ..|..:|:||..:..::
plant   383 GFGLTSVKNQSFSRASSRPTTPDPVIWYAPEVLAEMEQDLKGTAPRS-KFTHKADVYSFAMVCFE 446

  Fly   222 LQARRLPY--------------------------------------HTLDCNETIAYQVVKHELR 248
            |...::|:                                      |: :.::...:..:...||
plant   447 LITGKVPFEDDHLQGDKMAKNIRTGERPLFPFPSPKYLVSLIKRCWHS-EPSQRPTFSSICRILR 510

  Fly   249 ---------PDNYHQLKILALDSP-IDCDWDL 270
                     ||:.|    |.:.:| :|| |||
plant   511 YIKKFLVVNPDHGH----LQIQNPLVDC-WDL 537

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MosNP_610817.1 STKc_Mos 19..298 CDD:270881 56/292 (19%)
S_TKc 26..257 CDD:214567 49/276 (18%)
AT1G64300NP_001031229.1 DUF1221 21..237 CDD:284232
PKc_like 277..509 CDD:304357 44/257 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0192
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.