DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mos and AT5G66710

DIOPT Version :9

Sequence 1:NP_610817.1 Gene:Mos / 36404 FlyBaseID:FBgn0033773 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_201472.1 Gene:AT5G66710 / 836804 AraportID:AT5G66710 Length:405 Species:Arabidopsis thaliana


Alignment Length:370 Identity:85/370 - (22%)
Similarity:146/370 - (39%) Gaps:103/370 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 LGRGAYGTVFKAIYRD-RSVAVKIIRAQAASTLHNESH---------LLNLEHRNIVRLL----- 77
            :|.|:..||::.::|. ..|:|||.:.:..|.|..|..         |....|.||||.:     
plant    77 IGEGSSSTVYRGLFRRVVPVSVKIFQPKRTSALSIEQRKKFQREVLLLSKFRHENIVRFIGACIE 141

  Fly    78 -KLESAADFGLVIMECPRGQSLQRI---VDTLALPLMHRVLITLDVVAALRYCHSQNVLHLDVKP 138
             ||       ::|.|...|.:||:.   |....|.|...:...||:...:.:.::..::|.|:||
plant   142 PKL-------MIITELMEGNTLQKFMLSVRPKPLDLKLSISFALDIARGMEFLNANGIIHRDLKP 199

  Fly   139 TNILVALGTKSSITCNSSKIKVKRSYICKLCDFGSSIEMGE-FCAWQEPSVAKGTLRYMSPEALR 202
            :|:|:. |.:..:               ||.|||.:.|..: |..::     .||.|:|:||...
plant   200 SNMLLT-GDQKHV---------------KLADFGLAREETKGFMTFE-----AGTYRWMAPELFS 243

  Fly   203 SDTL--------TEASDIYSLGITMWQLQARRLPYHTLDCNETIAYQVVKH-------------- 245
            .|||        ....|:||..|..|:|...:.|:...: |..:||...|:              
plant   244 YDTLEIGEKKHYDHKVDVYSFAIVFWELLTNKTPFKGKN-NIFVAYAASKNQRPSVENLPEGVVS 307

  Fly   246 ----------ELRPD----NYHQLKIL-ALDSPIDCDWDLAHESTANVICRRANTS-ARRNLSLD 294
                      :.||:    .|....:| :|.|..|.   .:..|.||:....:.:| .:..:..|
plant   308 ILQSCWAENPDARPEFKEITYSLTNLLRSLSSDTDA---TSSNSKANIATEDSTSSLVQERVVCD 369

  Fly   295 -PSYTVGRDLKKKRHRNRLALHFDSPAPEGSACSESAYSQLYKSC 338
             |...:.:..|.|:..|:| ::...|           :.:::|||
plant   370 CPGLKMSKTKKLKKKTNKL-MNMIVP-----------FLKIFKSC 402

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MosNP_610817.1 STKc_Mos 19..298 CDD:270881 77/328 (23%)
S_TKc 26..257 CDD:214567 67/284 (24%)
AT5G66710NP_201472.1 STYKc 71..326 CDD:214568 66/277 (24%)
STKc_MAP3K-like 77..330 CDD:270901 67/281 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0192
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.