DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mos and AT5G50180

DIOPT Version :9

Sequence 1:NP_610817.1 Gene:Mos / 36404 FlyBaseID:FBgn0033773 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_199829.1 Gene:AT5G50180 / 835083 AraportID:AT5G50180 Length:346 Species:Arabidopsis thaliana


Alignment Length:270 Identity:68/270 - (25%)
Similarity:118/270 - (43%) Gaps:74/270 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 QLLKDGPPVPTRCQVLGRGAYGTVFKAIYRDRSVAVKIIR--------AQAASTLHNESHLLN-L 68
            |||..||.:       |.||:..|::..|::::||:||:.        |:..|....|..:|: :
plant    18 QLLFVGPKI-------GEGAHAKVYEGKYKNQTVAIKIVHRGETPEEIAKRDSRFLREVEMLSRV 75

  Fly    69 EHRNIVRLLKLESAADFG-------LVIMECPRGQSLQR-IVDTLALPLMHRVLI--TLDVVAAL 123
            :|:|:|:.:        |       :::.|..:|.:|:: :::.....|..||.|  .||:...:
plant    76 QHKNLVKFI--------GACKEPVMVIVTELLQGGTLRKYLLNLRPACLETRVAIGFALDIARGM 132

  Fly   124 RYCHSQNVLHLDVKPTNILVALGTKSSITCNSSKIKVKRSYICKLCDFGSSIEMGEFCAWQEPSV 188
            ...||..::|.|:||.|:|:....|:                .||.|||.:         :|.|:
plant   133 ECLHSHGIIHRDLKPENLLLTADHKT----------------VKLADFGLA---------REESL 172

  Fly   189 AK------GTLRYMSPEALRSDTL--------TEASDIYSLGITMWQLQARRLPYHTLDCNETIA 239
            .:      ||.|:|:||...:.||        ....|.||..|.:|:|...:||:..:. |...|
plant   173 TEMMTAETGTYRWMAPELYSTVTLRLGEKKHYNHKVDAYSFAIVLWELLHNKLPFEGMS-NLQAA 236

  Fly   240 YQVVKHELRP 249
            |......:||
plant   237 YAAAFKNVRP 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MosNP_610817.1 STKc_Mos 19..298 CDD:270881 64/264 (24%)
S_TKc 26..257 CDD:214567 63/257 (25%)
AT5G50180NP_199829.1 STKc_MAP3K-like 26..280 CDD:270901 63/262 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0192
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.