DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mos and AT5G41730

DIOPT Version :9

Sequence 1:NP_610817.1 Gene:Mos / 36404 FlyBaseID:FBgn0033773 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_001330018.1 Gene:AT5G41730 / 834176 AraportID:AT5G41730 Length:711 Species:Arabidopsis thaliana


Alignment Length:411 Identity:73/411 - (17%)
Similarity:135/411 - (32%) Gaps:169/411 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 SHLLNLEHRNIVRLLKLESAADFGLVIMECPRGQSLQRIVDTLALPLMHRVL------------- 114
            |.||.|.|.||::.|    ...:.....||           .|.:.|||:.|             
plant   279 SSLLALCHSNILQYL----CGFYDEERKEC-----------FLVMELMHKDLQSYMKENCGPRRR 328

  Fly   115 ----------ITLDVVAALRYCHSQNVLHLDVKPTNILVALGTKSSITCNSSKIKVKRSYICKLC 169
                      |.|.:...:.|.|..::.|.|:.|.||.:           ..:...:..:..|:|
plant   329 YLFSIPVVIDIMLQIARGMEYLHGNDIFHGDLNPMNIHL-----------KERSHTEGYFHAKIC 382

  Fly   170 DFG-SSIEMGEFCA---------WQEPSVAKGTLRYMSPEALRSDTLTEASDIYSLGITMWQLQA 224
            .|| ||:...:..:         |..|.|.....:.::.:..:| .||..:|:||..:..::|..
plant   383 GFGLSSVVKAQSSSKPGTPDPVIWYAPEVLAEMEQDLNGKTPKS-KLTHKADVYSFAMVCFELIT 446

  Fly   225 RRLPYH---------TLD-----------------------C---------NETIAYQVVKH--- 245
            .::|:.         |::                       |         |.:...:::::   
plant   447 GKVPFEDSHLQGEPMTINIRMGERPLFPFPSPKYLVSLIKRCWHSEPSQRPNFSSICRILRYIKK 511

  Fly   246 --ELRPDNYHQLKILALDSP-IDCDWDL-------------AHESTANVI--------------- 279
              .:.||:.|.    .:.:| :|| |||             :|.::.|.|               
plant   512 FLVVNPDHGHP----QMQTPLVDC-WDLEARFLRKFPGDAGSHTASVNQIPFQLYSYRVLEKEKM 571

  Fly   280 ----CRRANTSARRNLSL---DPSYTVGRDLKKKRHRNRLALHFDSPAPEGSACSE--SAYSQLY 335
                ...:.||...::|:   .|:..:.||.|                   |.|.:  |.||.. 
plant   572 NPNSKESSETSESESVSVVEDPPNAMITRDTK-------------------SLCLDTISEYSDT- 616

  Fly   336 KSCWVSAPELRLSSIQLKHEL 356
            :|.:..||..::|:::...|:
plant   617 RSVYSEAPMKKVSALKKSGEM 637

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MosNP_610817.1 STKc_Mos 19..298 CDD:270881 60/349 (17%)
S_TKc 26..257 CDD:214567 47/272 (17%)
AT5G41730NP_001330018.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0192
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.