DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mos and AT5G40540

DIOPT Version :9

Sequence 1:NP_610817.1 Gene:Mos / 36404 FlyBaseID:FBgn0033773 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_198870.1 Gene:AT5G40540 / 834052 AraportID:AT5G40540 Length:353 Species:Arabidopsis thaliana


Alignment Length:291 Identity:70/291 - (24%)
Similarity:126/291 - (43%) Gaps:68/291 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 LGRGAYGTVFKAIYRDRSVAVKIIR--------AQAASTLHNE-SHLLNLEHRNIVRLLKLESAA 83
            :|.||:..:::..|::::||:||::        |:..|....| |.|..::|:|:|:.:. ....
plant    32 IGEGAHAKIYEGKYKNKTVAIKIVKRGESPEEIAKRESRFAREVSMLSRVQHKNLVKFIG-ACKE 95

  Fly    84 DFGLVIMECPRGQSLQRIVDTL---ALPLMHRVLITLDVVAALRYCHSQNVLHLDVKPTNILVAL 145
            ...:::.|...|.:|::.:.:|   :|.:...|...||:..|:...||..|:|.|:||.::::..
plant    96 PIMVIVTELLLGGTLRKYLVSLRPGSLDIRVAVGYALDIARAMECLHSHGVIHRDLKPESLILTA 160

  Fly   146 GTKSSITCNSSKIKVKRSYICKLCDFGSSIEMGEFCAWQEPSVAK------GTLRYMSPEALRSD 204
            ..|:                .||.|||.:         :|.|:.:      ||.|:|:||...:.
plant   161 DYKT----------------VKLADFGLA---------REESLTEMMTAETGTYRWMAPELYSTV 200

  Fly   205 TLTEAS--------DIYSLGITMWQLQARRLPYHTLDCNETIAYQVVKHELRPDNYHQLKILALD 261
            ||....        |.||..|.:|:|...:||:..:. |...||......:||            
plant   201 TLRHGEKKHYNHKVDAYSFAIVLWELIHNKLPFEGMS-NLQAAYAAAFKNVRP------------ 252

  Fly   262 SPIDCDWDLAHESTANVICRRANTSARRNLS 292
            |..|...|||...|:   |.:.:.:.|.|.:
plant   253 SADDLPKDLAMIVTS---CWKEDPNDRPNFT 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MosNP_610817.1 STKc_Mos 19..298 CDD:270881 70/291 (24%)
S_TKc 26..257 CDD:214567 61/254 (24%)
AT5G40540NP_198870.1 STKc_MAP3K-like 32..286 CDD:270901 70/291 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0192
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.