DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mos and AT5G01850

DIOPT Version :9

Sequence 1:NP_610817.1 Gene:Mos / 36404 FlyBaseID:FBgn0033773 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_001332324.1 Gene:AT5G01850 / 831760 AraportID:AT5G01850 Length:357 Species:Arabidopsis thaliana


Alignment Length:383 Identity:84/383 - (21%)
Similarity:142/383 - (37%) Gaps:148/383 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 LGRGAYGTVFKAIYRDRSVAVKII--------RAQAASTLHNESHLLN-LEHRNIVRL-LKLESA 82
            :|.||:|.|::..|..:.||:|::        ::...|....|.:::: ::|.|:|:: |.|.|.
plant    24 IGEGAHGKVYQGRYGRQIVAIKVVNRGSKPDQQSSLESRFVREVNMMSRVQHHNLVKVSLLLSSL 88

  Fly    83 ADFGLVIME-----------CP-----------RGQSLQRIVDTLALPLMHRVL---ITLDVVAA 122
            :...::::|           |.           .|.||::.:.::...|:|..|   ..||:..|
plant    89 SLLSILLLEYTISIWQFIGACKDPLMVIVTELLPGMSLRKYLTSIRPQLLHLPLALSFALDIARA 153

  Fly   123 LRYCHSQNVLHLDVKPTNILVALGTKSSITCNSSKIKVKRSYICKLCDFGSSIEMGEFCAWQEPS 187
            |...|:..::|.|:||.|:|:....||                .||.|||.:         :|.|
plant   154 LHCLHANGIIHRDLKPDNLLLTENHKS----------------VKLADFGLA---------REES 193

  Fly   188 VAK------GTLRYMSPEALRSDTLTEAS--------DIYSLGITMWQLQARRLPYHTLDCNETI 238
            |.:      ||.|:|:||...:.||.:..        |:||.||.:|:|...|:|:..:. |...
plant   194 VTEMMTAETGTYRWMAPELYSTVTLRQGEKKHYNNKVDVYSFGIVLWELLTNRMPFEGMS-NLQA 257

  Fly   239 AYQVVKHELRPDNYHQLKILALDSPIDCDWDLAHESTANVICRRANTSARRNLSLDPSYTVGRDL 303
            ||.....:.||                                                      
plant   258 AYAAAFKQERP------------------------------------------------------ 268

  Fly   304 KKKRHRNRLALHFDSPAPEGSACSESAYSQLYKSCWVSAPELRLSSIQLKHEL-EFIL 360
                           ..|||.:.|   .:.:.:||||..|.:|.|..|:...| ||:|
plant   269 ---------------VMPEGISPS---LAFIVQSCWVEDPNMRPSFSQIIRLLNEFLL 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MosNP_610817.1 STKc_Mos 19..298 CDD:270881 68/318 (21%)
S_TKc 26..257 CDD:214567 68/277 (25%)
AT5G01850NP_001332324.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0192
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.