DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mos and AT4G31170

DIOPT Version :9

Sequence 1:NP_610817.1 Gene:Mos / 36404 FlyBaseID:FBgn0033773 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_001031758.1 Gene:AT4G31170 / 829245 AraportID:AT4G31170 Length:412 Species:Arabidopsis thaliana


Alignment Length:251 Identity:69/251 - (27%)
Similarity:113/251 - (45%) Gaps:47/251 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 RGAYGTVFKAIYRDRSVAVKII--------RAQAASTLHNE--SHLLNLEHRNIVRLLKLESAAD 84
            :||:|.:::..|....||:|::        :|||......:  |.|..|:|.||||.:.......
plant   139 QGAFGKLYRGTYNGEDVAIKLLERSDSNPEKAQALEQQFQQEVSMLAFLKHPNIVRFIGACIKPM 203

  Fly    85 FGLVIMECPRGQSLQRIV---DTLALPLMHRVLITLDVVAALRYCHSQNVLHLDVKPTNILVALG 146
            ...::.|..:|.|:::.:   ...|:||...|:..|||...:.|.|.:|.:|.|:|..|:|    
plant   204 VWCIVTEYAKGGSVRQFLTKRQNRAVPLKLAVMQALDVARGMAYVHERNFIHRDLKSDNLL---- 264

  Fly   147 TKSSITCNSSKIKVKRSYICKLCDFG-SSIEMGEFCAWQEPSVAKGTLRYMSPEALRSDTLTEAS 210
                       |...||  .|:.||| :.||:    ..:..:...||.|:|:||.::....|:..
plant   265 -----------ISADRS--IKIADFGVARIEV----QTEGMTPETGTYRWMAPEMIQHRPYTQKV 312

  Fly   211 DIYSLGITMWQLQARRLPYHTLDCNETIAYQVVKHELRPDNYHQLKILALDSPIDC 266
            |:||.||.:|:|....||:..:...:. |:.||...:||           ..|.||
plant   313 DVYSFGIVLWELITGLLPFQNMTAVQA-AFAVVNRGVRP-----------TVPADC 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MosNP_610817.1 STKc_Mos 19..298 CDD:270881 69/251 (27%)
S_TKc 26..257 CDD:214567 66/240 (28%)
AT4G31170NP_001031758.1 STKc_MAP3K-like 138..385 CDD:270901 69/251 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0192
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.