DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mos and AT3G50730

DIOPT Version :9

Sequence 1:NP_610817.1 Gene:Mos / 36404 FlyBaseID:FBgn0033773 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_190642.2 Gene:AT3G50730 / 824237 AraportID:AT3G50730 Length:371 Species:Arabidopsis thaliana


Alignment Length:369 Identity:97/369 - (26%)
Similarity:150/369 - (40%) Gaps:88/369 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 KQLLKDGPPVPTRCQVLGRGAYGTVFKAIYRDR-SVAVKIIRAQAAS--------TLHNESHLLN 67
            ::||.|...|... :::|.|||..|:|.:.|:: .|||||:.....|        |...|..||:
plant    27 RELLLDRNDVVVG-EMIGEGAYSIVYKGLLRNQFPVAVKIMDPSTTSAVTKAHKKTFQKEVLLLS 90

  Fly    68 -LEHRNIVRLLK--LESAADFGLVIMECPRGQSLQRIVDTLALPLMHRVLIT--LDVVAALRYCH 127
             ::|.|||:.:.  :|...   :::.|...|.:|||.:.:...||..::.::  ||:..|:.:.|
plant    91 KMKHDNIVKFVGACIEPQL---IIVTELVEGGTLQRFMHSRPGPLDLKMSLSFALDISRAMEFVH 152

  Fly   128 SQNVLHLDVKPTNILVALGTKSSITCNSSKIKVKRSYICKLCDFGSSIEM---GEFC-----AWQ 184
            |..::|.|:.|.|:||....|.                .||.|||.:.|.   |..|     .|.
plant   153 SNGIIHRDLNPRNLLVTGDLKH----------------VKLADFGIAREETRGGMTCEAGTSKWM 201

  Fly   185 EPSVAKGTLRYMSPEALRSDTLTE---ASDIYSLGITMWQLQARRLPYHTLDCNETIAYQVVKHE 246
            .|.|.      .|||.||.....|   .:||||..|.:|||.....|:..:..:..:.| :|...
plant   202 APEVV------YSPEPLRVGEKKEYDHKADIYSFAIVLWQLVTNEEPFPDVPNSLFVPY-LVSQG 259

  Fly   247 LRPDNYHQLKILALDSP------IDCDWDLAHESTANVICRRAN---TSARRNLSLDPSYTVGRD 302
            .||        :...:|      ::..|  |.:..|....:..:   |:..|.:|.|.|  :|..
plant   260 RRP--------ILTKTPDVFVPIVESCW--AQDPDARPEFKEISVMLTNLLRRMSSDSS--IGTT 312

  Fly   303 LKKKRHRNRLALHFDSPAPEGSACSESAYSQLYKS--CWVSAPE 344
            |.            |..|.||. ..||..|.|.:.  |.|..|:
plant   313 LP------------DGEAYEGE-MEESENSPLLQEHFCKVKKPK 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MosNP_610817.1 STKc_Mos 19..298 CDD:270881 81/312 (26%)
S_TKc 26..257 CDD:214567 71/255 (28%)
AT3G50730NP_190642.2 TyrKc 36..292 CDD:197581 76/292 (26%)
STKc_MAP3K-like 42..296 CDD:270901 75/289 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0192
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.