DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mos and AT3G50720

DIOPT Version :9

Sequence 1:NP_610817.1 Gene:Mos / 36404 FlyBaseID:FBgn0033773 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_190641.1 Gene:AT3G50720 / 824236 AraportID:AT3G50720 Length:377 Species:Arabidopsis thaliana


Alignment Length:253 Identity:66/253 - (26%)
Similarity:109/253 - (43%) Gaps:63/253 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 DLLLNTPKRKQLLKDGPPVPTRCQVLGRGAYGTVFKAIYRD-RSVAVKIIRAQAASTLHNESH-- 64
            :||||           |....|.:::|.|....|:|...:: ..|||||::....|.:..:..  
plant    40 ELLLN-----------PKDIMRGEMIGEGGNSIVYKGRLKNIVPVAVKIVQPGKTSAVSIQDKQQ 93

  Fly    65 -------LLNLEHRNIVRLLK--LESAADFGLVIMECPRGQSLQR-IVDTLALPLMHRVLIT--L 117
                   |.:::|.||||.:.  :|...   :::.|..||.:||| ::::...||..:|.::  |
plant    94 FQKEVLVLSSMKHENIVRFVGACIEPQL---MIVTELVRGGTLQRFMLNSRPSPLDLKVSLSFAL 155

  Fly   118 DVVAALRYCHSQNVLHLDVKPTNILVALGTKSSITCNSSKIKVKRSYICKLCDFGSSIEM---GE 179
            |:..|:.|.||:.::|.|:.|.|:||....|.                .||.|||.:.|.   |.
plant   156 DISRAMEYLHSKGIIHRDLNPRNVLVTGDMKH----------------VKLADFGLAREKTLGGM 204

  Fly   180 FCAWQEPSVAKGTLRYMSPEALRSDTL--------TEASDIYSLGITMWQLQARRLPY 229
            .|       ..||.|:|:||....:.|        .:..|:||..:..|.|...:.|:
plant   205 TC-------EAGTYRWMAPEVCSREPLRIGEKKHYDQKIDVYSFALIFWSLLTNKTPF 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MosNP_610817.1 STKc_Mos 19..298 CDD:270881 62/237 (26%)
S_TKc 26..257 CDD:214567 60/230 (26%)
AT3G50720NP_190641.1 STKc_MAP3K-like 54..304 CDD:270901 60/228 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0192
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.