DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mos and AT2G24360

DIOPT Version :9

Sequence 1:NP_610817.1 Gene:Mos / 36404 FlyBaseID:FBgn0033773 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_565568.1 Gene:AT2G24360 / 816972 AraportID:AT2G24360 Length:411 Species:Arabidopsis thaliana


Alignment Length:288 Identity:78/288 - (27%)
Similarity:121/288 - (42%) Gaps:57/288 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LKDGPPVPTRCQVLGRGAYGTVFKAIYRDRSVAVKII--------RAQAASTLHNE--SHLLNLE 69
            |..||       ...:||:|.::|..|....||:||:        :||.......:  |.|.||:
plant   130 LNMGP-------AFAQGAFGKLYKGTYNGEDVAIKILERPENSPEKAQFMEQQFQQEVSMLANLK 187

  Fly    70 HRNIVRLLKLESAADFGLVIMECPRGQSLQRIV---DTLALPLMHRVLITLDVVAALRYCHSQNV 131
            |.||||.:..........::.|..:|.|:::.:   ...|:||...|...|||...:.|.|.:|.
plant   188 HPNIVRFIGACRKPMVWCIVTEYAKGGSVRQFLTRRQNRAVPLKLAVKQALDVARGMAYVHGRNF 252

  Fly   132 LHLDVKPTNILVALGTKSSITCNSSKIKVKRSYICKLCDFG-SSIEMGEFCAWQEPSVAKGTLRY 195
            :|.|:|..|:|:: ..||                .|:.||| :.||:    ..:..:...||.|:
plant   253 IHRDLKSDNLLIS-ADKS----------------IKIADFGVARIEV----QTEGMTPETGTYRW 296

  Fly   196 MSPEALRSDTLTEASDIYSLGITMWQLQARRLPYHTLDCNETIAYQVVKHELRPDNYHQLKILAL 260
            |:||.::.....:..|:||.||.:|:|....||:..:...:. |:.||...:||           
plant   297 MAPEMIQHRAYNQKVDVYSFGIVLWELITGLLPFQNMTAVQA-AFAVVNRGVRP----------- 349

  Fly   261 DSPIDCDWDLAHESTANVICRRANTSAR 288
            ..|.||   |...|.....|..||...|
plant   350 TVPNDC---LPVLSDIMTRCWDANPEVR 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MosNP_610817.1 STKc_Mos 19..298 CDD:270881 76/284 (27%)
S_TKc 26..257 CDD:214567 66/244 (27%)
AT2G24360NP_565568.1 STKc_MAP3K-like 137..384 CDD:270901 75/274 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0192
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.