DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mos and Mlkl

DIOPT Version :9

Sequence 1:NP_610817.1 Gene:Mos / 36404 FlyBaseID:FBgn0033773 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_001297542.1 Gene:Mlkl / 74568 MGIID:1921818 Length:472 Species:Mus musculus


Alignment Length:338 Identity:75/338 - (22%)
Similarity:130/338 - (38%) Gaps:95/338 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 KQLLKD--GPPVPTRCQVLGRGAYGTVFKAIYRDRSVAVKII-RAQAAS------TLHNE-SHLL 66
            |::.|:  |||    ...|......|:::..|....|.:|:. ..||.|      |.::| ..:.
Mouse   184 KEIPKEHLGPP----WTKLKTSKMSTIYRGEYHRSPVTIKVFNNPQAESVGIVRFTFNDEIKTMK 244

  Fly    67 NLEHRNIVRLL-----KLESAADFGLVIMECPRGQSLQRIVD-TLALPLMHRVLITLDVVAALRY 125
            ..:..||:|:.     :.....:|.:|:..|..| :|:.::| ...|.:..|.|:.|.....|..
Mouse   245 KFDSPNILRIFGICIDQTVKPPEFSIVMEYCELG-TLRELLDREKDLTMSVRSLLVLRAARGLYR 308

  Fly   126 CHSQNVLHLDVKPTNILVALG------------TKSSITCNSSKIKVKRSYICKLCDFGSSIEMG 178
            .|....||.::..::.|||.|            |::||:..:...|.:||        .|:|   
Mouse   309 LHHSETLHRNISSSSFLVAGGYQVKLAGFELSKTQNSISRTAKSTKAERS--------SSTI--- 362

  Fly   179 EFCAWQEPSVAKGTLRYMSPEALRS-----DTLTEASDIYSLGITMWQLQARRLPYHTLDCNETI 238
                            |:|||.|::     |...|   |||.||.:|::...::|:.  .|:...
Mouse   363 ----------------YVSPERLKNPFCLYDIKAE---IYSFGIVLWEIATGKIPFE--GCDSKK 406

  Fly   239 AYQVVKHELRPDNYHQLKILALDSPIDCDWDLAHESTANVI--CRRANTSARRNLSLDPSYTVGR 301
            ..::|..:.:.:...|          ||.     |....:|  ||....|.|.::.       ||
Mouse   407 IRELVAEDKKQEPVGQ----------DCP-----ELLREIINECRAHEPSQRPSVD-------GR 449

  Fly   302 DLK-KKRHRNRLA 313
            .|. ::|...||:
Mouse   450 SLSGRERILERLS 462

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MosNP_610817.1 STKc_Mos 19..298 CDD:270881 66/311 (21%)
S_TKc 26..257 CDD:214567 56/261 (21%)
MlklNP_001297542.1 N-terminal bundle and brace (NBB), mediates INSP6 binding. /evidence=ECO:0000250|UniProtKB:Q8NB16 1..143
PHA02988 198..446 CDD:165291 64/295 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0192
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.