DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mos and PBK

DIOPT Version :9

Sequence 1:NP_610817.1 Gene:Mos / 36404 FlyBaseID:FBgn0033773 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_001265874.1 Gene:PBK / 55872 HGNCID:18282 Length:333 Species:Homo sapiens


Alignment Length:313 Identity:73/313 - (23%)
Similarity:123/313 - (39%) Gaps:79/313 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 KRKQLLKDGP----PVPTRCQVLGRGAYGTVFKAIYRDRSV--------AVKII--------RAQ 54
            |:|.:|...|    |.....|.||   :||........||.        |||.|        |:.
Human    16 KKKSVLCSTPTINIPASPFMQKLG---FGTGVNVYLMKRSPRGLSHSPWAVKKINPICNDHYRSV 77

  Fly    55 AASTLHNESHLL-NLEHRNIVRLLKLESAADFGLVI-MECPRGQSLQRIVDTL------ALPLMH 111
            ....|.:|:.:| :|.|.|||.......|.|..|.: ||....:||..:::..      ..|...
Human    78 YQKRLMDEAKILKSLHHPNIVGYRAFTEANDGSLCLAMEYGGEKSLNDLIEERYKASQDPFPAAI 142

  Fly   112 RVLITLDVVAALRYCHSQ-NVLHLDVKPTNILVALGTKSSITCNSSKIKVKRSYICKLCDFGSSI 175
            .:.:.|::...|:|.|.: .:||.|:|.:|:::. |...:|               |:||.|.|:
Human   143 ILKVALNMARGLKYLHQEKKLLHGDIKSSNVVIK-GDFETI---------------KICDVGVSL 191

  Fly   176 EMGE-----------FCAWQEPSVAK-GTLRYMSPEALRSD-TLTEASDIYSLGITMWQLQARRL 227
            .:.|           ..:..:|.... ||..:...||:..: .:|:.:||::.|:|:|::....:
Human   192 PLDENMTAPAFITILLVSVTDPEACYIGTEPWKPKEAVEENGVITDKADIFAFGLTLWEMMTLSI 256

  Fly   228 PYHTL-----DCNETI--------AYQVVKHELRPDNYHQL-----KILALDS 262
            |:..|     |.::|.        ||........|.|..:|     |::.|.|
Human   257 PHINLSNDDDDEDKTFDESDFDDEAYYAALGTRPPINMEELDESYQKVIELFS 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MosNP_610817.1 STKc_Mos 19..298 CDD:270881 70/304 (23%)
S_TKc 26..257 CDD:214567 65/286 (23%)
PBKNP_001265874.1 PKc_TOPK 32..332 CDD:270903 68/297 (23%)
Pkinase 34..327 CDD:278497 68/295 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0192
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.