DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mos and Ilk

DIOPT Version :9

Sequence 1:NP_610817.1 Gene:Mos / 36404 FlyBaseID:FBgn0033773 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_525001.2 Gene:Ilk / 53573 FlyBaseID:FBgn0028427 Length:448 Species:Drosophila melanogaster


Alignment Length:286 Identity:66/286 - (23%)
Similarity:112/286 - (39%) Gaps:76/286 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGDLLLNTPKRKQLLKDGPPVPTRCQVLGRGAYGTVFKAIYRDRSVAVKIIRAQAA----STLHN 61
            ||||.|:|.                  |.....|..::..::...|..||:..:..    |...|
  Fly   189 MGDLDLHTK------------------LSVTPSGETWRGRWQKNDVVAKILAVRQCTPRISRDFN 235

  Fly    62 ES--HLLNLEHRNIVRLL-KLESAADFGLVIMECPRGQ--SLQR-----IVDTLALPLMHRVLIT 116
            |.  .|....|.||:.:: ...|..:...:....||..  ||..     :|||     ...|...
  Fly   236 EEFPKLRIFSHPNILPIIGACNSPPNLVTISQFMPRSSLFSLLHGATGVVVDT-----SQAVSFA 295

  Fly   117 LDVVAALRYCHS-QNVLHLDVKPTNILVALGTKSSITCNSSKIKVKRSYICKLCDFGSSIEMGEF 180
            |||...:.:.|| :.::     ||..|           ||..:.:..       |..:.|.||:.
  Fly   296 LDVARGMAFLHSLERII-----PTYHL-----------NSHHVMIDD-------DLTARINMGDA 337

  Fly   181 -CAWQEPSVAKGTL---RYMSPEAL---RSDTLTEASDIYSLGITMWQLQARRLPY---HTLDCN 235
             .::||    ||.:   .:||||.|   ::|...||.|::|..|.:|:|..|.:|:   ..::|.
  Fly   338 KFSFQE----KGRIYQPAWMSPETLQRKQADRNWEACDMWSFAILIWELTTREVPFAEWSPMECG 398

  Fly   236 ETIAYQVVKHELRP-DNYHQLKILAL 260
            ..||.:.::.::.| .:.|..|::::
  Fly   399 MKIALEGLRVKIPPGTSTHMAKLISI 424

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MosNP_610817.1 STKc_Mos 19..298 CDD:270881 60/268 (22%)
S_TKc 26..257 CDD:214567 59/256 (23%)
IlkNP_525001.2 ANK 28..140 CDD:238125
ANK repeat 33..64 CDD:293786
Ank_2 38..130 CDD:289560
ANK repeat 66..97 CDD:293786
ANK repeat 99..130 CDD:293786
PK_ILK 196..446 CDD:270959 61/279 (22%)
STYKc 204..443 CDD:214568 59/253 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445253
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.