DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mos and Map3k9

DIOPT Version :9

Sequence 1:NP_610817.1 Gene:Mos / 36404 FlyBaseID:FBgn0033773 Length:364 Species:Drosophila melanogaster
Sequence 2:XP_038968662.1 Gene:Map3k9 / 500690 RGDID:1562149 Length:1140 Species:Rattus norvegicus


Alignment Length:378 Identity:81/378 - (21%)
Similarity:140/378 - (37%) Gaps:120/378 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 PPVP---------TRCQVLGRGAYGTVFKAIYRDRSVAVKIIR-------AQAASTLHNESHLL- 66
            ||:.         |..:::|.|.:|.|::|.:....||||..|       :|....:..|:.|. 
  Rat   125 PPIQLLEIDFAELTLEEIIGIGGFGKVYRAFWVGDEVAVKAARHDPDEDISQTIENVRQEAKLFA 189

  Fly    67 NLEHRNIVRL----LKLESAADFGLVIMECPRGQSLQRIVDTLALPLMHRVLITLDVVAALRYCH 127
            .|:|.||:.|    ||..:..    ::||..||..|.|::....:|....|...:.:...:.|.|
  Rat   190 MLKHPNIIALRGVCLKEPNLC----LVMEFARGGPLNRVLSGKRVPPDILVNWAVQIARGMNYLH 250

  Fly   128 SQ---NVLHLDVKPTNI---LVALGTKSSITCNSSKI----KVKRSYI----CKLCDFGSSIEMG 178
            .:   .|:|.|:|.:|.   .:..|.:.|::....::    ||:...:    .|:.|||.:.|  
  Rat   251 DEAIVPVIHRDLKSSNSECGELGWGEQHSLSLRLCEVLILQKVENGDLSNKTLKITDFGLARE-- 313

  Fly   179 EFCAWQEPS--VAKGTLRYMSPEALRSDTLTEASDIYSLGITMWQLQARRLPYHTLDCNETIAYQ 241
                |...:  .|.||..:|:||.:|:...::.||::|.|:.:|:|....:|:..:| ...:||.
  Rat   314 ----WHRTTKMSAAGTYAWMAPEVIRASMFSKGSDVWSYGVLLWELLTGEVPFRGID-GLAVAYG 373

  Fly   242 VVKHELRPDNYHQLKILALDSPIDCDWDLAHESTANVICRRANTSARRNLSLDPSYTVGRDLKKK 306
            |.                                                               
  Rat   374 VA--------------------------------------------------------------- 375

  Fly   307 RHRNRLALHFDSPAPEGSACSESAYSQLYKSCWVSAPELRLSSIQLKHELEFI 359
              .|:|||...|..||       .:::|.:.||...|..|.|...:..:|..|
  Rat   376 --MNKLALPIPSTCPE-------PFAKLMEDCWNPDPHSRPSFSSILDQLTTI 419

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MosNP_610817.1 STKc_Mos 19..298 CDD:270881 66/315 (21%)
S_TKc 26..257 CDD:214567 63/258 (24%)
Map3k9XP_038968662.1 SH3_MLK1-3 49..106 CDD:212992
STKc_MLK1 130..419 CDD:271047 78/371 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0192
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.