DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mos and slpr

DIOPT Version :9

Sequence 1:NP_610817.1 Gene:Mos / 36404 FlyBaseID:FBgn0033773 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_001188558.1 Gene:slpr / 44111 FlyBaseID:FBgn0030018 Length:1155 Species:Drosophila melanogaster


Alignment Length:355 Identity:84/355 - (23%)
Similarity:131/355 - (36%) Gaps:115/355 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 QVLGRGAYGTVFKAIYRDRSVAVKI--------IRAQAASTLHNESHLLNLEHRNIVRL------ 76
            :|:|.|.:..|.:..|....||:||        ::....:.|........|:|.||..|      
  Fly   133 EVIGSGGFCKVHRGYYDGEEVAIKIAHQTGEDDMQRMRDNVLQEAKLFWALKHENIAALRGVCLN 197

  Fly    77 LKLESAADFGLVIMECPRGQSLQRIVDTLALPLMHRVLI--TLDVVAALRYCHSQ---NVLHLDV 136
            .||       .::||..||.||.||   ||..:...||:  .:.:...:.|.|::   :::|.|:
  Fly   198 TKL-------CLVMEYARGGSLNRI---LAGKIPPDVLVNWAIQIARGMNYLHNEAPMSIIHRDL 252

  Fly   137 KPTNILVALGTKSSITCNSSKIKVKRSYICKLCDFGSSIEMGEFCAWQEPSVAKGTLRYMSPEAL 201
            |.:|:|:    ..:|..|..:.|.     .|:.|||.:.||..   .|..|.| ||..:|.||.:
  Fly   253 KSSNVLI----YEAIEGNHLQQKT-----LKITDFGLAREMYN---TQRMSAA-GTYAWMPPEVI 304

  Fly   202 RSDTLTEASDIYSLGITMWQLQARRLPYHTLDCNETIAYQVVKHELRPDNYHQLKILALDSPIDC 266
            ...|.::.||::|.|:.:|:|.....||...| ..::||.|..                      
  Fly   305 SVSTYSKFSDVWSYGVLLWELITGETPYKGFD-PLSVAYGVAV---------------------- 346

  Fly   267 DWDLAHESTANVICRRANTSARRNLSLDPSYTVGRDLKKKRHRNRLALHFDSPAPEGSACSESAY 331
                                                       |.|.|    |.|:  .|.|: :
  Fly   347 -------------------------------------------NTLTL----PIPK--TCPET-W 361

  Fly   332 SQLYKSCWVSAPELRLSSIQLKHELEFILC 361
            ..|.||||.:.|..|....::..:||.|.|
  Fly   362 GALMKSCWQTDPHKRPGFKEILKQLESIAC 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MosNP_610817.1 STKc_Mos 19..298 CDD:270881 66/290 (23%)
S_TKc 26..257 CDD:214567 66/249 (27%)
slprNP_001188558.1 SH3_MLK 47..104 CDD:212809
TyrKc 129..386 CDD:197581 80/348 (23%)
STKc_MLK 134..389 CDD:270963 82/350 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445265
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0192
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.