DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mos and MOS

DIOPT Version :9

Sequence 1:NP_610817.1 Gene:Mos / 36404 FlyBaseID:FBgn0033773 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_005363.1 Gene:MOS / 4342 HGNCID:7199 Length:346 Species:Homo sapiens


Alignment Length:277 Identity:81/277 - (29%)
Similarity:129/277 - (46%) Gaps:61/277 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LKDGPPVPTR---CQV----------LGRGAYGTVFKAIYRDRSVAVKII------RAQAASTLH 60
            |...|.:|.|   |.:          ||.|.:|:|:||.||...||:|.:      |..:..:..
Human    40 LPRAPRLPRRLAWCSIDWEQVCLLQRLGAGGFGSVYKATYRGVPVAIKQVNKCTKNRLASRRSFW 104

  Fly    61 NESHLLNLEHRNIVRLLKLES-----AADFGLVIMECPRGQSLQRIVDTLA-------------- 106
            .|.::..|.|.||||::...:     :...|.:|||.....:|.:::...|              
Human   105 AELNVARLRHDNIVRVVAASTRTPAGSNSLGTIIMEFGGNVTLHQVIYGAAGHPEGDAGEPHCRT 169

  Fly   107 ---LPLMHRVLITLDVVAALRYCHSQNVLHLDVKPTNILVALGTKSSITCNSSKIKVKRSYICKL 168
               |.|...:..:||||..|.:.|||:::|||:||.|||::                 ...:||:
Human   170 GGQLSLGKCLKYSLDVVNGLLFLHSQSIVHLDLKPANILIS-----------------EQDVCKI 217

  Fly   169 CDFGSSIEMGEFCAWQEPSV-AKGTLRYMSPEALRSDTLTEASDIYSLGITMWQLQARRLPYHTL 232
            .|||.|.::.:...:|.||. ..||..:.:||.|:.:.:|..:||||..||:||:..::.||.  
Human   218 SDFGCSEKLEDLLCFQTPSYPLGGTYTHRAPELLKGEGVTPKADIYSFAITLWQMTTKQAPYS-- 280

  Fly   233 DCNETIAYQVVKHELRP 249
            ...:.|.|.||.::|||
Human   281 GERQHILYAVVAYDLRP 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MosNP_610817.1 STKc_Mos 19..298 CDD:270881 80/273 (29%)
S_TKc 26..257 CDD:214567 76/263 (29%)
MOSNP_005363.1 STKc_Mos 56..338 CDD:270881 76/261 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143773
Domainoid 1 1.000 109 1.000 Domainoid score I6401
eggNOG 1 0.900 - - E2759_KOG0192
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 109 1.000 Inparanoid score I4911
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D420914at33208
OrthoFinder 1 1.000 - - FOG0009419
OrthoInspector 1 1.000 - - oto88487
orthoMCL 1 0.900 - - OOG6_109630
Panther 1 1.100 - - LDO PTHR23257
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5036
SonicParanoid 1 1.000 - - X7157
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1312.830

Return to query results.
Submit another query.