DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mos and MAP3K10

DIOPT Version :9

Sequence 1:NP_610817.1 Gene:Mos / 36404 FlyBaseID:FBgn0033773 Length:364 Species:Drosophila melanogaster
Sequence 2:XP_011525283.1 Gene:MAP3K10 / 4294 HGNCID:6849 Length:962 Species:Homo sapiens


Alignment Length:235 Identity:63/235 - (26%)
Similarity:113/235 - (48%) Gaps:29/235 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 QVLGRGAYGTVFKAIYRDRSVAVKIIR-------AQAASTLHNESHLLN-LEHRNIVRLLKLESA 82
            :::|.|.:|.|::|::|...||||..|       |..|..:..|:.|.. |:|.||:.|......
Human   102 EIIGVGGFGKVYRALWRGEEVAVKAARLDPEKDPAVTAEQVCQEARLFGALQHPNIIALRGACLN 166

  Fly    83 ADFGLVIMECPRGQSLQRIVDTLALPLMHRVLITLDVVAALRYCHSQ---NVLHLDVKPTNILVA 144
            .....::||..||.:|.|::....:|....|...:.|...:.|.|:.   .::|.|:|..|||:.
Human   167 PPHLCLVMEYARGGALSRVLAGRRVPPHVLVNWAVQVARGMNYLHNDAPVPIIHRDLKSINILIL 231

  Fly   145 LGTKSSITCNSSKIKVKRSYICKLCDFGSSIEMGEFCAWQEPS--VAKGTLRYMSPEALRSDTLT 207
            ...::....::         :.|:.|||.:.|      |.:.:  .|.||..:|:||.:|....:
Human   232 EAIENHNLADT---------VLKITDFGLARE------WHKTTKMSAAGTYAWMAPEVIRLSLFS 281

  Fly   208 EASDIYSLGITMWQLQARRLPYHTLDCNETIAYQVVKHEL 247
            ::||::|.|:.:|:|....:||..:|. ..:||.|..::|
Human   282 KSSDVWSFGVLLWELLTGEVPYREIDA-LAVAYGVAMNKL 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MosNP_610817.1 STKc_Mos 19..298 CDD:270881 63/235 (27%)
S_TKc 26..257 CDD:214567 63/235 (27%)
MAP3K10XP_011525283.1 SH3_MLK1-3 20..76 CDD:212992
TyrKc 98..365 CDD:197581 63/235 (27%)
PKc_like 103..368 CDD:304357 63/234 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0192
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.