DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mos and cdi

DIOPT Version :9

Sequence 1:NP_610817.1 Gene:Mos / 36404 FlyBaseID:FBgn0033773 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_524401.2 Gene:cdi / 42289 FlyBaseID:FBgn0004876 Length:1213 Species:Drosophila melanogaster


Alignment Length:284 Identity:59/284 - (20%)
Similarity:103/284 - (36%) Gaps:90/284 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 GDLLLNTPKRKQLLKDG-------PPVP-TR------------CQVL------------------ 28
            ||.....|.:.|.|.:|       ||.| ||            |:.|                  
  Fly    52 GDATAEAPVKHQPLHNGGWIGNGLPPAPVTRTISSDRLVTGSSCRALRTAVSALYSVDDFVKEKI 116

  Fly    29 GRGAYGTVFKAIYRDRSVAVKI----IRAQAASTLHNESHLLN-LEHRNIVRLLKLESAADFGLV 88
            |.|.:..|:|..:|.....:.:    :||...:.| .|..||| |.|.||:..:        |:.
  Fly   117 GSGFFSEVYKVTHRTTGQVMVLKMNQLRANRPNML-REVQLLNKLSHANILSFM--------GVC 172

  Fly    89 IMECP--------RGQSLQRIV--DTLALPLMHRVLITLDVVAALRYCHSQNVLHLDVKPTNILV 143
            :.|..        .|.||::::  ..:.|....::.:.|.:...:.|.|...:.|.|:...|:|:
  Fly   173 VQEGQLHALTEYINGGSLEQLLANKEVVLSATQKIRLALGIARGMSYVHDAGIFHRDLTSKNVLI 237

  Fly   144 ALGTKSSITCNSSKIKVKRSYICKLCDFGSSIEMGEFCAWQEPSVAK-------GTLRYMSPEAL 201
                         :......|...:.|||.:.::        |..::       |:..::|||.|
  Fly   238 -------------RNLANDQYEAVVGDFGLAAKI--------PVKSRKSRLETVGSPYWVSPECL 281

  Fly   202 RSDTLTEASDIYSLGITMWQLQAR 225
            :.....:.||::|.||...::.||
  Fly   282 KGQWYDQTSDVFSFGIIQCEIIAR 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MosNP_610817.1 STKc_Mos 19..298 CDD:270881 53/260 (20%)
S_TKc 26..257 CDD:214567 47/240 (20%)
cdiNP_524401.2 TyrKc 113..363 CDD:197581 46/223 (21%)
PKc_like 116..370 CDD:304357 46/220 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445269
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.