DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mos and zgc:85936

DIOPT Version :9

Sequence 1:NP_610817.1 Gene:Mos / 36404 FlyBaseID:FBgn0033773 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_999909.1 Gene:zgc:85936 / 406563 ZFINID:ZDB-GENE-040426-2450 Length:927 Species:Danio rerio


Alignment Length:161 Identity:30/161 - (18%)
Similarity:60/161 - (37%) Gaps:22/161 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   184 QEPSVAKGTLRYMSPEALRSDT----LTEASDIYSLGITMWQLQARRLPYHTLDCNETI------ 238
            ||....:.....:|.:::.|.|    ::..||.:.....:|..:....|..:..|...:      
Zfish   137 QEDDAPRFHYSLLSEDSVLSSTHLSSISRTSDKHRETAALWLSELVEEPVMSSTCVSAVDPVLLS 201

  Fly   239 AYQVVKHELRPDNYHQLKILALDSPIDCDWDLAHESTANVICRRANTSARRNLSLDPSYTVGRDL 303
            |:.....:...|.:       .|:..|...| ||..........|:|.|:.:..:.||:: ||..
Zfish   202 AHTDAHTDAHTDAH-------TDAHTDAHTD-AHTDAHTDAHTDAHTDAQTDCEVSPSFS-GRSQ 257

  Fly   304 KKKRHRNRLALHFDS---PAPEGSACSESAY 331
            ::.:...|.|..:.|   |.|:....::|.:
Zfish   258 QELQKSLRAADEYFSILCPHPQLHPSADSTF 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MosNP_610817.1 STKc_Mos 19..298 CDD:270881 22/123 (18%)
S_TKc 26..257 CDD:214567 12/82 (15%)
zgc:85936NP_999909.1 ANK 10..124 CDD:238125
ANK repeat 10..36 CDD:293786
Ank_5 25..82 CDD:290568
ANK repeat 38..72 CDD:293786
ANK repeat 74..105 CDD:293786
LEM 674..710 CDD:240585
GIY-YIG_COG3680_Meta 766..880 CDD:198401
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0192
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.