DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mos and LOC405768

DIOPT Version :9

Sequence 1:NP_610817.1 Gene:Mos / 36404 FlyBaseID:FBgn0033773 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_001353900.1 Gene:LOC405768 / 405768 -ID:- Length:477 Species:Danio rerio


Alignment Length:338 Identity:75/338 - (22%)
Similarity:147/338 - (43%) Gaps:69/338 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 GRGAYGTVFKA--IYRDRSVAV-KIIRAQAASTLHNESHLLN-LEHRNIVRLL-KLESAADFGLV 88
            |.|::|:|::|  :.:|:.||| |:::..|      |:.:|: |.|:||::.. .:..|.::|:|
Zfish    54 GGGSFGSVYRAHWVPQDKEVAVKKLLKIDA------EAEILSVLSHKNIIQFYGAILEAPNYGIV 112

  Fly    89 IMECPRGQSLQRI--VDTLALPLMHRVLITLDVVAALRYCHSQ---NVLHLDVKPTNILVALGTK 148
            .....||...:.:  .|:..:.:...:...:::...:.|.|::   .|:|.|:|..|::      
Zfish   113 TEYASRGSLYEYLSSADSEEMDMDQVMTWAMEIAKGMHYLHAEAPLKVIHRDLKSRNVV------ 171

  Fly   149 SSITCNSSKIKVKRSYICKLCDFGSSIEMGEFCAWQEPSVAKGTLRYMSPEALRSDTLTEASDIY 213
              :|.::         :.|:||||:|    :..:........||..:|:||.::|..::|..|.|
Zfish   172 --LTADN---------VLKICDFGAS----KMVSHTTHMSLVGTFPWMAPEVIQSLPVSETCDTY 221

  Fly   214 SLGITMWQLQARRLPYHTLDCNETIAYQVVKHELRPDNYHQLKILALDSPIDCDWDLAHESTANV 278
            |.|:.:|::..|.:|:...:..:.....|.||| ||           ..|..|.     .|.|::
Zfish   222 SYGVVLWEMLTREVPFKGFEGLQVAWLVVEKHE-RP-----------TIPSSCP-----ASFADL 269

  Fly   279 ICRRANTSARRNLSLDPSYTVGRDLKKKRHRNRLALHFDSPAPEGSACSESAYSQLYKSCWVSAP 343
            :.|..|...:.........:....:|.           ||..|:  .|:...:::....|.:...
Zfish   270 MRRCWNAEPKERPQFKQILSTLETMKN-----------DSKLPD--QCNSFLHNKAEWRCEIEET 321

  Fly   344 ELRLSSIQLKHEL 356
            ..||.  ||:.||
Zfish   322 LERLK--QLEREL 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MosNP_610817.1 STKc_Mos 19..298 CDD:270881 63/278 (23%)
S_TKc 26..257 CDD:214567 57/237 (24%)
LOC405768NP_001353900.1 STKc_MLTK 53..294 CDD:270962 63/283 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0192
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.