DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mos and Ripk2

DIOPT Version :9

Sequence 1:NP_610817.1 Gene:Mos / 36404 FlyBaseID:FBgn0033773 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_001178794.1 Gene:Ripk2 / 362491 RGDID:1309167 Length:539 Species:Rattus norvegicus


Alignment Length:373 Identity:88/373 - (23%)
Similarity:141/373 - (37%) Gaps:111/373 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 LGRGAYGTVFKAIYRDRSVAVKIIRAQAASTLHNESHLLNLEHRNIVRLLKLESAADF------- 85
            |.|||.|||..|.:.|..|.|      |...||..:.||:.|..:|:|..::...|.|       
  Rat    24 LSRGASGTVSSARHADWRVRV------AVKHLHIHTPLLDSERNDILREAEILHKARFSYILPIL 82

  Fly    86 ---------GLVIMECPRGQSLQRIV------DTLALPLMHRVLITLDVVAALRYCHSQN--VLH 133
                     |:|....|.| ||..::      ..:|.||..|:|  .::...:.|.|:.|  :||
  Rat    83 GICNEPEFLGIVTEYMPNG-SLNELLHRKTEYPEIAWPLRFRIL--HEIALGVNYLHNMNPPLLH 144

  Fly   134 LDVKPTNILVALGTKSSITCNSSKIKVKRSYICKLCDFGSSIEMGEFCAWQEPSVAK-------- 190
            .|:|..|||                 :...:..|:.|||.|       .|:..|:::        
  Rat   145 HDLKTQNIL-----------------LDNEFHVKIADFGLS-------KWRMMSLSQSRSYKSAP 185

  Fly   191 --GTLRYMSPEALRSDTLTEAS---DIYSLGITMWQLQARRLPYHTLDCNETIAYQVVKHELRPD 250
              ||:.||.||.......:.||   ||||..:.||::.:|:.|:..:.....|.|.|.:.. ||:
  Rat   186 EGGTIIYMPPENYEPGQKSRASVKHDIYSYAVIMWEVLSRKQPFEEVTNPLQIMYSVSQGH-RPN 249

  Fly   251 NYHQLKILALDSPIDCDWDLAHESTANVICRRA---NTSARRN-----LSLDPSYTVGRD----- 302
            .          |..:..:|:.|......:.:..   |...|.:     :.|:|......|     
  Rat   250 T----------SEENLPFDIPHRGLMISLIQSGWAQNPDERPSFLKCLIELEPVLRTFEDITFLE 304

  Fly   303 ----LKKKRHRN----------RLALHFDSPA---PEGSACSESAYSQ 333
                |||.:.::          ::.|..:.||   |:..:|..|..|:
  Rat   305 AVIQLKKSKIQSASSTIHLCDKKMDLSLNIPASHPPQEESCGSSLLSR 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MosNP_610817.1 STKc_Mos 19..298 CDD:270881 77/314 (25%)
S_TKc 26..257 CDD:214567 70/265 (26%)
Ripk2NP_001178794.1 STKc_RIP2 20..303 CDD:270928 78/322 (24%)
STYKc 21..290 CDD:214568 75/309 (24%)
CARD_RIP2_CARD3 437..523 CDD:176764
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0192
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.