DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mos and pbk

DIOPT Version :9

Sequence 1:NP_610817.1 Gene:Mos / 36404 FlyBaseID:FBgn0033773 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_001002387.1 Gene:pbk / 360218 ZFINID:ZDB-GENE-030523-2 Length:339 Species:Danio rerio


Alignment Length:201 Identity:53/201 - (26%)
Similarity:90/201 - (44%) Gaps:34/201 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 AVKIIRAQAA--------STLHNESHLL-NLEHRNIVRLLKLESAADFG-LVIMECPRGQSLQRI 101
            |:|.|.::.|        ..|..|:.:| :|:|.|||......:|.|.. .:.||....|||..:
Zfish    65 AIKKINSKCAQGQVSVYQKRLCEEAKILKDLKHPNIVGFRAFTTAKDGSKCLAMEFGGEQSLNDL 129

  Fly   102 VD------TLALPLMHRVLITLDVVAALRYCHSQ-NVLHLDVKPTNILVALGTKSSITCNSSKIK 159
            ::      ..|.|:.....:.|.|...|.|.|:: .:||.|:|..|:::. |...||        
Zfish   130 IEKRREEGLQAFPVDTIEKVALHVARGLLYLHNEKKLLHGDMKSCNVVIK-GDFESI-------- 185

  Fly   160 VKRSYICKLCDFGSSIEMGEFCAWQEPSVAK-GTLRYMSPEALRSDTLTEASDIYSLGITMWQLQ 223
                   |:||.|.|:.:.|.....:|.... ||..:...|||....:|:.:||::.|:|:|::.
Zfish   186 -------KICDVGVSLPLDENMQVSDPKAHYIGTEPWKPKEALEDGVITDKADIFAYGLTLWEMM 243

  Fly   224 ARRLPY 229
            ...:|:
Zfish   244 TLSVPH 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MosNP_610817.1 STKc_Mos 19..298 CDD:270881 53/201 (26%)
S_TKc 26..257 CDD:214567 53/201 (26%)
pbkNP_001002387.1 PKc_TOPK 36..325 CDD:270903 53/201 (26%)
Pkinase_Tyr 38..322 CDD:285015 53/201 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0192
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.