Sequence 1: | NP_610817.1 | Gene: | Mos / 36404 | FlyBaseID: | FBgn0033773 | Length: | 364 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001002387.1 | Gene: | pbk / 360218 | ZFINID: | ZDB-GENE-030523-2 | Length: | 339 | Species: | Danio rerio |
Alignment Length: | 201 | Identity: | 53/201 - (26%) |
---|---|---|---|
Similarity: | 90/201 - (44%) | Gaps: | 34/201 - (16%) |
- Green bases have known domain annotations that are detailed below.
Fly 47 AVKIIRAQAA--------STLHNESHLL-NLEHRNIVRLLKLESAADFG-LVIMECPRGQSLQRI 101
Fly 102 VD------TLALPLMHRVLITLDVVAALRYCHSQ-NVLHLDVKPTNILVALGTKSSITCNSSKIK 159
Fly 160 VKRSYICKLCDFGSSIEMGEFCAWQEPSVAK-GTLRYMSPEALRSDTLTEASDIYSLGITMWQLQ 223
Fly 224 ARRLPY 229 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Mos | NP_610817.1 | STKc_Mos | 19..298 | CDD:270881 | 53/201 (26%) |
S_TKc | 26..257 | CDD:214567 | 53/201 (26%) | ||
pbk | NP_001002387.1 | PKc_TOPK | 36..325 | CDD:270903 | 53/201 (26%) |
Pkinase_Tyr | 38..322 | CDD:285015 | 53/201 (26%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG0192 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |