DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mos and CG8173

DIOPT Version :9

Sequence 1:NP_610817.1 Gene:Mos / 36404 FlyBaseID:FBgn0033773 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_573239.1 Gene:CG8173 / 32753 FlyBaseID:FBgn0030864 Length:398 Species:Drosophila melanogaster


Alignment Length:346 Identity:88/346 - (25%)
Similarity:138/346 - (39%) Gaps:112/346 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LNTPKRKQLLK--------------DGPPVPTRCQVLGRGAYGTVFKAIYRDRSVAVKIIRAQAA 56
            ::||:||  |:              :.||.| ..:.||   :||..:....|||..:..||:..|
  Fly     1 MDTPRRK--LRNLHLENVQNSSTPINVPPSP-MMKTLG---HGTGIRVYRLDRSPRLGEIRSPWA 59

  Fly    57 ------------STLHNES--H----LLNLEHRNIV------------RLLKLE-SAADFGLVIM 90
                        .||.||.  |    |..|:|.|||            ..|.|| .....|.::.
  Fly    60 VKRITQNMRVKKDTLFNERIVHEADILRKLKHPNIVGFRGVITNDEGINTLALEMCTTSLGSILE 124

  Fly    91 ECPRGQSLQRIVDTLALPLMHRVLITLDVVAALRYCHSQ-NVLHLDVKPTNILVALGTKSSITCN 154
            |       :...|...||..|...:.:||..||.:.|:: :::|.|:|..|:|            
  Fly   125 E-------RHDEDLGPLPAKHTYKMIMDVAQALDFLHNEAHLMHGDLKSFNVL------------ 170

  Fly   155 SSKIKVKRSY-ICKLCDFGSSI---EMGEFCAWQEPSVA-KGTLRYMSPEAL-RSDTLTEASDIY 213
                 ||..: ||||||||.|:   |.||....:.|.:. .||..:.:||.: ..|.:...:||:
  Fly   171 -----VKGEFEICKLCDFGVSLPLDEQGEVNFLKNPGLRYVGTNLWCAPEVIDEVDVIDSKADIF 230

  Fly   214 SLGITMWQLQARRLPYHTLDCNETIAYQVVKHELRPDNYHQLKILALDSPIDCDWDLAHE---ST 275
            |.|:.:::..| .:|.|||:                          ||:.:..|.|.:|:   .|
  Fly   231 SFGLVIYETLA-LVPPHTLE--------------------------LDAALGEDMDSSHDLPTDT 268

  Fly   276 ANVICRRANTSARRNLSLDPS 296
            ..:.|::.:.|:..|.:..||
  Fly   269 DKLQCKQLDFSSDENKNGLPS 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MosNP_610817.1 STKc_Mos 19..298 CDD:270881 83/319 (26%)
S_TKc 26..257 CDD:214567 69/268 (26%)
CG8173NP_573239.1 PKc_like 28..389 CDD:304357 81/317 (26%)
S_TKc 30..>245 CDD:214567 65/242 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0192
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.