DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mos and Takl1

DIOPT Version :9

Sequence 1:NP_610817.1 Gene:Mos / 36404 FlyBaseID:FBgn0033773 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_732554.1 Gene:Takl1 / 318725 FlyBaseID:FBgn0046689 Length:393 Species:Drosophila melanogaster


Alignment Length:321 Identity:81/321 - (25%)
Similarity:131/321 - (40%) Gaps:86/321 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 LGRGAYGTVFKAIYRDRSVAVKI-------IRAQAASTLHNESHLLNLEHRNIVRLLKLESAADF 85
            ||.|:.|.|.||.::::.:||||       |:..|...:   :||..::|.|::|::...|....
  Fly    17 LGAGSGGAVRKATFQNQEIAVKIFDFLEETIKKNAEREI---THLSEIDHENVIRVIGRASNGKK 78

  Fly    86 GLVIMECPRGQSLQRIV---DTLALPLMHRVLITLDVVAALRYCHS--QNVLHLDVKPTNILVAL 145
            ..::||.....||...:   |.....:...|...|....||.|.||  :.::|.|:||.|:|:  
  Fly    79 DYLLMEYLEEGSLHNYLYGDDKWEYTVEQAVRWALQCAKALAYLHSLDRPIVHRDIKPQNMLL-- 141

  Fly   146 GTKSSITCNSSKIKVKRSYICKLCDFGSSIEMGEFCAWQEPSVAKGTLRYMSPEALRSDTLTEAS 210
                          ..:....|:||||.:.:|.     ...:..:||||||:|||::....|...
  Fly   142 --------------YNQHEDLKICDFGLATDMS-----NNKTDMQGTLRYMAPEAIKHLKYTAKC 187

  Fly   211 DIYSLGITMWQLQARRLPYHTLDCNETIAYQVVK----------HELR---PDNYHQLKILALD- 261
            |:||.||.:|:|..|:|||..|: |....|.::|          ..:|   |:...||....:| 
  Fly   188 DVYSFGIMLWELMTRQLPYSHLE-NPNSQYAIMKAISSGEKLPMEAVRSDCPEGIKQLMECCMDI 251

  Fly   262 ----------------------------SPIDCDWDLAHESTANVICRRANTSARRNLSLD 294
                                        .|:|       |.|..|:....::|..|.:.:|
  Fly   252 NPEKRPSMKEIEKFLGEQYESGTDEDFIKPLD-------EDTVAVVTYHVDSSGSRIMRVD 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MosNP_610817.1 STKc_Mos 19..298 CDD:270881 81/321 (25%)
S_TKc 26..257 CDD:214567 72/253 (28%)
Takl1NP_732554.1 S_TKc 15..262 CDD:214567 73/269 (27%)
STKc_TAK1 17..274 CDD:270960 73/281 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444231
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0192
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.