DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mos and Map3k7

DIOPT Version :9

Sequence 1:NP_610817.1 Gene:Mos / 36404 FlyBaseID:FBgn0033773 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_001101390.2 Gene:Map3k7 / 313121 RGDID:1309438 Length:606 Species:Rattus norvegicus


Alignment Length:221 Identity:63/221 - (28%)
Similarity:104/221 - (47%) Gaps:48/221 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 QVLGRGAYGTVFKAIYRDRSVAVKIIRAQA--ASTLHNESHLLNLEHRNIVRLLKLESAADFG-- 86
            :|:||||:|.|.||.:|.:.||:|.|.:::  .:.:.....|..:.|.|||:|        :|  
  Rat    40 EVVGRGAFGVVCKAKWRAKDVAIKQIESESERKAFIVELRQLSRVNHPNIVKL--------YGAC 96

  Fly    87 ----LVIMECPRGQSLQRIVDTLALPL-----MHRVLITLDVVAALRYCHSQN---VLHLDVKPT 139
                .::||...|.||..::.. |.||     .|.:...|.....:.|.||..   ::|.|:||.
  Rat    97 LNPVCLVMEYAEGGSLYNVLHG-AEPLPYYTAAHAMSWCLQCSQGVAYLHSMQPKALIHRDLKPP 160

  Fly   140 N-ILVALGTKSSITCNSSKIKVKRSYICKLCDFGSSIEMGEFCAWQEPSVAKGTLRYMSPEALRS 203
            | :|||.||                 :.|:||||::.::     ....:..||:..:|:||....
  Rat   161 NLLLVAGGT-----------------VLKICDFGTACDI-----QTHMTNNKGSAAWMAPEVFEG 203

  Fly   204 DTLTEASDIYSLGITMWQLQARRLPY 229
            ...:|..|::|.||.:|::..||.|:
  Rat   204 SNYSEKCDVFSWGIILWEVITRRKPF 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MosNP_610817.1 STKc_Mos 19..298 CDD:270881 63/221 (29%)
S_TKc 26..257 CDD:214567 63/221 (29%)
Map3k7NP_001101390.2 Interaction with MAPK8IP1. /evidence=ECO:0000250 1..300 63/221 (29%)
TyrKc 36..284 CDD:197581 63/221 (29%)
STKc_TAK1 42..292 CDD:270960 62/219 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 301..338
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 354..391
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 443..492
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0192
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.