DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mos and Map3k10

DIOPT Version :9

Sequence 1:NP_610817.1 Gene:Mos / 36404 FlyBaseID:FBgn0033773 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_001382027.1 Gene:Map3k10 / 308463 RGDID:1308381 Length:940 Species:Rattus norvegicus


Alignment Length:368 Identity:80/368 - (21%)
Similarity:135/368 - (36%) Gaps:115/368 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 PPVPTRCQ--------------VLGRGAYGTVFKAIYRDRSVAVKIIR-------AQAASTLHNE 62
            |..||..|              ::|.|.:|.|::|::|...||||..|       |..|..:..|
  Rat    81 PAAPTDLQLPQEIPFHELQLEEIIGVGGFGKVYRALWRGEEVAVKAARLDPERDPAVTAEQVRQE 145

  Fly    63 SHLLN-LEHRNIVRLLKLESAADFGLVIMECPRGQSLQRIVDTLALPLMHRVLITLDVVAALRYC 126
            :.|.. |:|.||:.|.....:.....::||..||.:|.|::....:|....|...:.|...:.|.
  Rat   146 ARLFGALQHPNIIALRGACLSPPNLCLVMEYARGGALSRVLAGRRVPPHVLVNWAVQVARGMNYL 210

  Fly   127 HSQ---NVLHLDVKPTNILVALGTKSSITCNSSKIKVKRSYICKLCDFGSSIEMGEFCAWQEPS- 187
            |:.   .::|.|:|..|||:....::....::         :.|:.|||.:.|      |.:.: 
  Rat   211 HNDAPVPIIHRDLKSINILILEAIENHNLADT---------VLKITDFGLARE------WHKTTK 260

  Fly   188 -VAKGTLRYMSPEALRSDTLTEASDIYSLGITMWQLQARRLPYHTLDCNETIAYQVVKHELRPDN 251
             .|.||..:|:||.:|....:::||::|.|:.:|:|....:||..:|. ..:||.|.        
  Rat   261 MSAAGTYAWMAPEVIRLSLFSKSSDVWSFGVLLWELLTGEVPYREIDA-LAVAYGVA-------- 316

  Fly   252 YHQLKILALDSPIDCDWDLAHESTANVICRRANTSARRNLSLDPSYTVGRDLKKKRHRNRLALHF 316
                                                                     .|:|.|..
  Rat   317 ---------------------------------------------------------MNKLTLPI 324

  Fly   317 DSPAPEGSACSESAYSQLYKSCWVSAPELRLSSIQLKHELEFI 359
            .|..||       .:::|.:.||...|..|.....:..:||.|
  Rat   325 PSTCPE-------PFARLLEECWDPDPHGRPDFGSILKQLEVI 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MosNP_610817.1 STKc_Mos 19..298 CDD:270881 66/305 (22%)
S_TKc 26..257 CDD:214567 63/257 (25%)
Map3k10NP_001382027.1 Leucine-zipper 1 384..405
Leucine-zipper 2 419..440
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 490..599
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 639..658
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 687..733
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 748..916
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0192
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.