DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mos and Ripk1

DIOPT Version :9

Sequence 1:NP_610817.1 Gene:Mos / 36404 FlyBaseID:FBgn0033773 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_001100820.1 Gene:Ripk1 / 306886 RGDID:1310158 Length:658 Species:Rattus norvegicus


Alignment Length:234 Identity:62/234 - (26%)
Similarity:101/234 - (43%) Gaps:46/234 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 LGRGAYGTVFKAIYRDRSVAV--KII----RAQAASTLHNESHLLN-LEHRNIVRLLK-LESAAD 84
            |..|.:|.|....:|.....:  |:.    ||:....|..|..::: |.|..:|:||. :....:
  Rat    23 LDSGGFGKVSLCFHRTHGFVILKKVYTGPNRAEYNEALLEEGKMMHRLRHDRVVKLLGIIIEEGN 87

  Fly    85 FGLVIMECPRGQSLQRIVDTLALPLMHRVLITLDVVAALRYCHSQNVLHLDVKPTNILVALGTKS 149
            :.||:....:|..:..:....::||..:..|.::::..:.|.|.:.|:|.|:||.|||       
  Rat    88 YSLVMEYMEQGNLMHVLKTKESVPLSVKGRIIVEIIEGMHYLHDEGVIHKDLKPENIL------- 145

  Fly   150 SITCNSSKIKVKRSYICKLCDFGSSIEMGEFCAW------------QEPSVAK---GTLRYMSPE 199
                      |.|.:..|:.|.|    :..|..|            :..||.|   |||.||:||
  Rat   146 ----------VDRDFHIKIADLG----VASFKTWSKLTKEEHNKQREASSVTKKNGGTLYYMAPE 196

  Fly   200 ALR--SDTLTEASDIYSLGITMWQLQARRLPYHTLDCNE 236
            .|.  :...||.||:||..|.:|.:.|.:.||..:.|.|
  Rat   197 HLTDINTKPTEKSDVYSFAIVLWAIFANKEPYENVICTE 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MosNP_610817.1 STKc_Mos 19..298 CDD:270881 62/234 (26%)
S_TKc 26..257 CDD:214567 62/234 (26%)
Ripk1NP_001100820.1 PKc_like 23..290 CDD:419665 62/234 (26%)
Death_RIP1 570..655 CDD:260048
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0192
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.