DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mos and Dstyk

DIOPT Version :9

Sequence 1:NP_610817.1 Gene:Mos / 36404 FlyBaseID:FBgn0033773 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_955750.1 Gene:Dstyk / 304791 RGDID:735051 Length:927 Species:Rattus norvegicus


Alignment Length:253 Identity:65/253 - (25%)
Similarity:102/253 - (40%) Gaps:89/253 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 DLLLNTPKRKQLLKDGPPVPTRCQVLGRGAYGTVF-------------KAI-------YRDRSVA 47
            |:||:   ||         |...|.||||.||.|:             |::       :.|.::.
  Rat   643 DVLLH---RK---------PKLGQELGRGQYGVVYLCDNWGGHFPCALKSVVPPDEKHWNDLALE 695

  Fly    48 VKIIRAQAASTLHNESHLLNLEHRNIVRLLKLESAADFG-------LVIMECPRGQSLQRIVDT- 104
            ...:|     :|.....|::| |.:::..       ::|       |:|||     .|.|.:.| 
  Rat   696 FHYMR-----SLPKHERLVDL-HGSVIDY-------NYGGGSSVAVLLIME-----RLHRDLYTG 742

  Fly   105 --LALPLMHRVLITLDVVAALRYCHSQNVLHLDVKPTNILVALGTKSSITCNSSKIKVKRSYICK 167
              ..|.|..|:.|.||||..:|:.|||.::|.|:|..|:|:....::.||               
  Rat   743 LKAGLSLETRLQIALDVVEGIRFLHSQGLVHRDIKLKNVLLDKQNRAKIT--------------- 792

  Fly   168 LCDFGSSIEMGEFC---AWQEPSVAKGTLRYMSPEALRSDTLTEASDIYSLGITMWQL 222
              |.|       ||   |....|:. ||..:|:|| |.:.....:.|:|:.||..|.:
  Rat   793 --DLG-------FCKPEAMMSGSIV-GTPIHMAPE-LFTGKYDNSVDVYAFGILFWYI 839

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MosNP_610817.1 STKc_Mos 19..298 CDD:270881 60/237 (25%)
S_TKc 26..257 CDD:214567 59/230 (26%)
DstykNP_955750.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..21
PKc_Dusty 649..910 CDD:270877 61/244 (25%)
S_TKc 651..895 CDD:214567 59/233 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0192
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.